KEGG   Pongo abelii (Sumatran orangutan): 100446540
Entry
100446540         CDS       T01416                                 

Gene name
G6PC
Definition
(RefSeq) glucose-6-phosphatase isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100446540 (G6PC)
   00052 Galactose metabolism
    100446540 (G6PC)
   00500 Starch and sucrose metabolism
    100446540 (G6PC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100446540 (G6PC)
   04151 PI3K-Akt signaling pathway
    100446540 (G6PC)
   04152 AMPK signaling pathway
    100446540 (G6PC)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100446540 (G6PC)
   04922 Glucagon signaling pathway
    100446540 (G6PC)
   04920 Adipocytokine signaling pathway
    100446540 (G6PC)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100446540 (G6PC)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100446540 (G6PC)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100446540 (G6PC)
SSDB
Motif
Pfam: PAP2 DUF373
Other DBs
NCBI-GeneID: 100446540
NCBI-ProteinID: XP_024091006
LinkDB
Position
17
AA seq 359 aa
MRMEEGMNVLHDFGIQSTHYLQVNYEDSQDWFILVSAIADLRNAFYVLFPIWFHLQEAVG
IKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSG
HAMGTAGVYYVMVTSTLSIFRGKKKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFP
HQVVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTL
EKAQRWCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSS
IVASLILLHLFDSLKPPSQVELVFYVLSFCKSAVVPLASVSIIPYCLAQVLGQPHKKSL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaggatggaggaaggaatgaatgttctccatgactttgggatccagtcaacacattac
ctccaggtgaattacgaagactcccaggactggttcatcttggtgtccgcgatagcagac
ctcaggaatgccttctacgtcctcttccccatctggttccatcttcaggaagctgtgggc
attaaactcctctgggtagctgtgattggagactggctcaacctcgtctttaagtggatt
ctctttggacagcgtccatactggtgggttttggataccgactactacagcaacacttcc
gtgcccctgataaagcagttccctgtaacctgtgagactggaccagggagcccctctggc
catgccatgggtacagcaggtgtatactacgtgatggtcacgtctactctttccatcttt
cggggaaagaaaaagccgacctacagatttcggtgcttgaatgtcattttgtggttggga
ttctgggctgtgcagctgaatgtctgtctgtcacgaatctaccttgctgctcattttcct
catcaagttgttgccggagtcctgtcaggcattgctgttgcagaaactttcagccacatc
cacagcatctataatgccagcctcaagaaatatttcctcattaccttcttcctgttcagc
tttgccatcggattttatctgctgctcaagggactgggtgtggacctcctgtggactctg
gagaaagcccagaggtggtgcgagcggccagaatgggtccacattgacaccacgcccttt
gccagcctcctcaagaacctgggcaccctctttggcctggggctggctctcaactccagc
atgtacagggagagctgcaaggggaaactcagcaagtggctcccattccgcctcagctct
attgtagcctccctcatcctcctgcacctctttgactccttgaaacccccgtcccaagtc
gagctggtcttctacgtcttgtccttctgcaagagtgcggtagtgcccctagcatccgtc
agcatcatcccctactgcctcgcccaggtcctgggccagccgcacaagaagtcgttgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100453765
Entry
100453765         CDS       T01416                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase 2 isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100453765 (G6PC2)
   00052 Galactose metabolism
    100453765 (G6PC2)
   00500 Starch and sucrose metabolism
    100453765 (G6PC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100453765 (G6PC2)
   04151 PI3K-Akt signaling pathway
    100453765 (G6PC2)
   04152 AMPK signaling pathway
    100453765 (G6PC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100453765 (G6PC2)
   04922 Glucagon signaling pathway
    100453765 (G6PC2)
   04920 Adipocytokine signaling pathway
    100453765 (G6PC2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100453765 (G6PC2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100453765 (G6PC2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100453765 (G6PC2)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 100453765
NCBI-ProteinID: XP_002812607
Ensembl: ENSPPYG00000012907
UniProt: H2P7R0
LinkDB
Position
2B
AA seq 355 aa
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLWFQLNQTVGTKMIWV
AVIGDWFNLIFKWILFGDRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFALGFYLLLRLLNIDLLWSVSVAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNSYTLSFRLLCALTS
LTTLQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYCVHMLMKQSGKKIQ
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggatttccttcacaggaatggagtgctcataattcagcatttgcagaaggactaccga
gcttactatacttttctaaattttatgtccaatgttggagacccccggaatatctttttc
atttattttccactttggtttcaacttaatcagacagttggaaccaagatgatatgggta
gcagtcattggggattggttcaatcttatatttaaatggatattatttggtgatcgacct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccctactacatgcgaaacaggtccaggaagtccatctggccatgcaatgggctcgtcc
tgtgtctggtatgtcatggtaaccgctgccctgagccacactgtctgtgggatggataag
ttctctatcactctgcacagactgacctggtcatttctttggagtgttttttggttgatt
caaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcatgctggtggcagaggcctttgaacacactccaggcatccaa
acggccagtctgggcacatacctgaagaccaacctcttcctcttcctgtttgcacttggc
ttttacctgcttcttagactgctcaacattgacctgctgtggtccgtgtccgtagccaaa
aagtggtgtgccaaccccgactggatccacattgataccacgccttttgctggactcgtg
agaaacctcggggtcctgtttggcttgggctttgcaatcaactcggagatgttcctgctg
agctgccgaggaggaaatagctacacactgagcttccggttgctctgtgccttgacctcg
ttgaccacactgcagctctaccatttcctccagatcccgactcacgaagagcatttattt
tacgtgctgtctttttgtaaaagtgcatccattcccctaactgtagttgctttcattccc
tactgtgttcatatgttaatgaaacaaagtggaaagaagattcagtag

KEGG   Pongo abelii (Sumatran orangutan): 100458617
Entry
100458617         CDS       T01416                                 

Gene name
G6PC3
Definition
(RefSeq) glucose-6-phosphatase 3 isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100458617 (G6PC3)
   00052 Galactose metabolism
    100458617 (G6PC3)
   00500 Starch and sucrose metabolism
    100458617 (G6PC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100458617 (G6PC3)
   04151 PI3K-Akt signaling pathway
    100458617 (G6PC3)
   04152 AMPK signaling pathway
    100458617 (G6PC3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100458617 (G6PC3)
   04922 Glucagon signaling pathway
    100458617 (G6PC3)
   04920 Adipocytokine signaling pathway
    100458617 (G6PC3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100458617 (G6PC3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100458617 (G6PC3)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100458617 (G6PC3)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 100458617
NCBI-ProteinID: XP_002827498
Ensembl: ENSPPYG00000008343
UniProt: A0A663D8W3 H2NTV5
LinkDB
Position
17
AA seq 346 aa
MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWI
SLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGA
ALWPIMTALSSQVATRARSRWVRVMPSLAYCTFLLAVGLSRIFILAHFPHQVLAGLITGA
VLGWLMTPRVPMERELSFYGLIALALMLGTSLIYWTLFTLGLDLSWSISLAFKWCERPEW
IHMDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWL
GHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagtccacgctgggcgcgggcatcgtgatagccgaggcgctacagaaccagctagcc
tggctggagaacgtgtggctctggatcacctttctgggcgatcccaagatcctctttctg
ttctacttccccgcggcctactacgcctcccgccgtgtgggcatcgcggtgctctggatc
agcctcatcaccgagtggctcaacctcatcttcaagtggtttctttttggagacaggccc
ttttggtgggtccatgagtctgggtactatagccaggctccagcccaggttcaccagttc
ccctcttcttgtgagactggtccaggcagcccttctggacactgcatgatcacaggagca
gccctctggcccataatgacggccctgtcttcgcaggtggccactcgggcccgcagccgc
tgggtaagggtgatgcctagcctggcttattgcaccttccttttggcggttggcttgtcg
cgaatcttcatcttagcacatttccctcaccaggtgctggctggcctaataactggtgct
gtcctgggctggctgatgactccccgagtgcctatggagcgggagctaagcttctatggg
ttgattgcactggccctcatgctaggcaccagcctcatctattggaccctctttacgctg
ggcctggatctttcttggtccatcagcctagccttcaagtggtgtgagcggcctgagtgg
atacacatggatagccggccctttgcctccctgagccgtgactcaggggctgccctgggc
ctgggcattgccttgcactctccctgctatgcccaggtgcgtcgggcacagctgggaaat
ggccagaagatagcctgccttgtgctggccatggggctgctgggccccctggactggctg
ggccacccccctcagatcagcctcttctacattttcaatttcctcaagtacaccctctgg
ccatgcctagtcctggccctcgtgccctgggcagtgcacatgttcagtgcccaggaagca
ccgcccatccactcttcctga

DBGET integrated database retrieval system