KEGG   Pongo abelii (Sumatran orangutan): 100446808
Entry
100446808         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cationic amino acid transporter 3-like
  KO
K13865  solute carrier family 7 (cationic amino acid transporter), member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100446808
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100446808
SSDB
Motif
Pfam: AA_permease_C AA_permease
Other DBs
NCBI-GeneID: 100446808
NCBI-ProteinID: XP_024093608
LinkDB
Position
19
AA seq 638 aa
MVWQNIRQLGRKLMRRWPLQLGQEGSEHRLSRCLKTLDLVALGVGSTLGAGVYVLAGEVA
KEKAGPAMVICFLVPVLTSMLSGLCYAEGPGSHAPVFSRDGVLVEPCSSSAYLYTXVTVG
ELVAFITSWNLLLSYVIGAASVAKAWSFAFDSLIGKHISHALQGTSLHLPQVLAXDFFAL
GLVLVLTGLLALGAREXAWVSKVFTGVNLLVLSCLIVSGFIKGDLHNWQLTDADYKRAEL
GGGGSNDTHSLGSPGSGGFVPFDFGGILHGAATCFFAFVGFDGVATTGEAALHPHHSIPL
GTVTSIFICFLAYFGVSAALTLMVPYYLICPENPLPEAFVHIGWAPIRYAVAIGTLCALS
SSLLGAMFPTPRVLYLMAEEGLLFRGLARIHARTSTPVVATVIAGTVAAIMAFLFELGDL
VNLSSIGTMLAYSLVAFSVLVLRYQPDQNFSKNEKPKEEVVEMNSVPKAKSPECVPEASS
TLASLWSPVSTIPTPRSGRIVCGCAFVLVVLLSMLCLVLAHWPKRLFSGELIYIAAAVLL
LVLIVGFTFTIWRQPQSNTPLYFKVPLLPVLQLVSVSVRVYLMMQMTTETSAQFGVWMLI
GFAMYFGYGIRHSLENDQQPPASSSQTPHENIPSSLLN
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggtctggcagaatattcgccaacttggtcggaagttgatgcgcaggtggcccctgcag
ctgggccaggagggctctgagcatcgcttgtctcgttgtctgaagaccctggatctggtg
gccttgggtgtgggcagcaccctgggagcgggcgtgtatgtcctggctggagaagtggcc
aaagagaaagctggaccggccatggtcatctgcttcttggtgccggtgctgacttctatg
ttgtctggactctgctatgcagaggggcctgggagccatgcccctgtttttagtagagac
ggggttttagtagagccatgctccagttccgcctatctctacacttaggtcacagtgggt
gaactggtggctttcatcaccagctggaacctcttactctcctacgtcattggtgccgcc
agcgtggccaaggcctggagctttgcgtttgacagcctgatcgggaagcacatctcccat
gccctgcagggcacttctctgcacctgcctcaagtcctggccnaagacttttttgcactg
ggcctggtgttggtcctcactggactgctggctctgggagctcgggagtgagcctgggtt
tccaaagtcttcacaggtgtgaaccttttggttctgagctgcctcatcgtctccggcttc
atcaagggagatctgcacaactggcagctcacagacgccgactacaaacgggccgagctg
ggggggggggggtccaacgacacccacagcttgggctccccgggctctggagggtttgtg
ccttttgactttggcgggattctccacggagcagccacgtgtttctttgcgtttgtgggt
tttgatggcgtcgccaccacaggagaagcagccctccaccctcaccactccatccccttg
ggcaccgtgacctcgatcttcatctgcttcttggcctattttggtgtctcagcagcgctc
accctcatggtgccctactacctgatatgtcctgagaaccccttgccggaggctttcgtc
cacattggatgggcccccatcagatatgctgtggccatcggcaccctctgtgccctgtct
tccagcctcctgggtgccatgttccccacgcctcgcgtgctctacttaatggctgaggaa
gggctccttttccgcggactcgcccggatccacgcccgcaccagcacccctgtggtggcc
actgtcattgctgggaccgttgcagcaatcatggctttcctgtttgagctcggtgacctt
gtgaacctctcgtccatcgggaccatgcttgcttactccttggtggccttttctgttctt
gtcctcaggtaccagccagaccagaatttcagcaagaatgagaagccgaaggaggaagta
gttgagatgaattctgtacccaaagcaaaatccccagaatgtgttcctgaagcgtccagc
actctggcgagtctgtggagccctgtgagcaccatccccaccccgagatcaggccgcatc
gtctgtggatgtgcctttgtgcttgttgtcctgctgtccatgctatgcctggtattggcc
cattggcccaaacgcctgttctctggagagctgatctacattgcagcggctgtgttgctg
ctggtgctcattgtgggattcactttcaccatctggagacagccccagagcaacactcct
ctttatttcaaggtccccctgttgcctgtccttcagttggtcagcgtctctgtgcgtgtt
tacctgatgatgcagatgaccactgagacctcggcccaatttggagtctggatgttgatt
ggatttgctatgtattttggatatgggatccgacacagcttggagaacgatcaacagcca
ccagcgtcaagctcccaaactcctcatgaaaacatccctagttccttgctgaattag

DBGET integrated database retrieval system