KEGG   Pongo abelii (Sumatran orangutan): 100447772
Entry
100447772         CDS       T01416                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04012  ErbB signaling pathway
pon04062  Chemokine signaling pathway
pon04110  Cell cycle
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04310  Wnt signaling pathway
pon04340  Hedgehog signaling pathway
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04657  IL-17 signaling pathway
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04722  Neurotrophin signaling pathway
pon04728  Dopaminergic synapse
pon04910  Insulin signaling pathway
pon04916  Melanogenesis
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05135  Yersinia infection
pon05160  Hepatitis C
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100447772 (GSK3B)
   04310 Wnt signaling pathway
    100447772 (GSK3B)
   04340 Hedgehog signaling pathway
    100447772 (GSK3B)
   04390 Hippo signaling pathway
    100447772 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100447772 (GSK3B)
   04150 mTOR signaling pathway
    100447772 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100447772 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100447772 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100447772 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100447772 (GSK3B)
   04657 IL-17 signaling pathway
    100447772 (GSK3B)
   04662 B cell receptor signaling pathway
    100447772 (GSK3B)
   04062 Chemokine signaling pathway
    100447772 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100447772 (GSK3B)
   04917 Prolactin signaling pathway
    100447772 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100447772 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100447772 (GSK3B)
   04916 Melanogenesis
    100447772 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100447772 (GSK3B)
   04722 Neurotrophin signaling pathway
    100447772 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100447772 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447772 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100447772 (GSK3B)
   05225 Hepatocellular carcinoma
    100447772 (GSK3B)
   05226 Gastric cancer
    100447772 (GSK3B)
   05217 Basal cell carcinoma
    100447772 (GSK3B)
   05215 Prostate cancer
    100447772 (GSK3B)
   05213 Endometrial cancer
    100447772 (GSK3B)
   05224 Breast cancer
    100447772 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100447772 (GSK3B)
   05020 Prion disease
    100447772 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100447772 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100447772 (GSK3B)
   04931 Insulin resistance
    100447772 (GSK3B)
   04934 Cushing syndrome
    100447772 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100447772 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100447772 (GSK3B)
   05162 Measles
    100447772 (GSK3B)
   05163 Human cytomegalovirus infection
    100447772 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100447772 (GSK3B)
   05165 Human papillomavirus infection
    100447772 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100447772 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100447772 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100447772 (GSK3B)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100447772 (GSK3B)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100447772 (GSK3B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100447772 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100447772
NCBI-ProteinID: XP_024100347
Ensembl: ENSPPYG00000013507
LinkDB
Position
3
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggacggcagcaaggtgacaacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctacacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcgggagaa
ctggtcgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccagatc
atgagaaagctagaccactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccgcagaatctcttgttggatcctgatacagccgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggat
agtggtgtggatcagttggtagaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cgaactccaccggaggcaattgcactgtgtagccgtctgctggagtatacaccaactgcc
cgactaacaccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctggctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccccacaaatgccacagcagcctcagatgctaatactggagaccgtggacag
accaataatgctgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system