KEGG   Pongo abelii (Sumatran orangutan): 100448375
Entry
100448375         CDS       T01416                                 

Gene name
SLC7A5
Definition
(RefSeq) large neutral amino acids transporter small subunit 1
  KO
K13780  solute carrier family 7 (L-type amino acid transporter), member 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100448375 (SLC7A5)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100448375 (SLC7A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100448375 (SLC7A5)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100448375 (SLC7A5)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 100448375
NCBI-ProteinID: XP_002826781
Ensembl: ENSPPYG00000007633
UniProt: A0A6D2XEH9 H2NRQ9
LinkDB
Position
16
AA seq 507 aa
MAGAGPKRRALAAPAAEEKEEAREKMLAAKRADGAVPAGEGEGVTLQRNITLLNGVAIIV
GTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYM
LEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVL
LLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIGKGDVSNLDPKFSFEGTKLDV
GNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTL
STEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLP
SILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRY
RKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKN
KPKWLLQGIFSTTVLCQKLMQVVPQET
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcgggtgcgggcccgaagcggcgcgcgctggcggccccggcggccgaggagaaggaa
gaggcgcgggagaagatgctggccgccaagcgcgcggacggcgcggtgccggcaggcgag
ggcgagggcgtgaccctgcagcggaacatcacgctgctcaacggcgtggccatcatcgtg
ggcaccatcatcggctcgggcatcttcgtgacgcccacgggcgtgctcaaggaggcaggc
tcgccggggctggcgctggtggtgtgggccgcgtgcggcgtcttctccatcgtgggcgcg
ctctgctacgcggagctgggcaccaccatctccaaatcgggcggcgactacgcctacatg
ctggaggtctacggctcgctgcccgccttcctcaagctctggatcgagctgctcatcatc
cggccttcatcgcagtacatcgtggccctggtcttcgccacctacctgctcaagcctctc
ttccccacctgcccggtgcccgaggaggcagccaagctcgtggcctgcctctgcgtgctg
ctgctcacggccgtgaactgctacagcgtgaaggccgccacccgggtccaggatgccttt
gccgccgccaagctcctggccctggccctgatcatcctgctgggcttcgtccagatcggg
aagggtgatgtgtccaatctagatcccaagttctcatttgaaggcaccaaactggatgtg
gggaacattgtgctggcattatacagcggcctctttgcctatggaggatggaattacttg
aatttcgtcacagaggaaatgatcaacccctacagaaacctgcccctggccatcatcatc
tccctgcccattgtgacgctggtgtacgtgctgaccaacctggcctatttcaccacactg
tccaccgagcagatgctgtcgtccgaggccgtggccgtggactttgggaactatcacctg
ggcgtcatgtcctggatcatccccgtcttcgtgggcctgtcctgcttcggctccgtcaat
gggtccctgttcacatcctccagactcttcttcgtggggtcccgggaaggccacctgccc
tccattctctccatgatccacccacagctcctcacccccgtgccgtccctcgtgttcacg
tgtgtgatgacgctgctctacgccttctccaaggacatattctccgtcatcaacttcttc
agcttcttcaactggctctgcgtggccctggccatcatcggcatgatctggctgcgctac
agaaagcctgagcttgagcggcccattaaggtgaacctggccctgcccgtgttcttcatc
ctggcctgcctcttcctgatcgctgtctccttctggaagacacccgtggagtgtggcatc
ggcttcaccatcatcctcagcgggctgcccgtctacttcttcggggtctggtggaaaaac
aagcccaagtggctcctccagggcatcttctccacgaccgtcctgtgtcagaagctcatg
caggtggtcccccaggagacatag

DBGET integrated database retrieval system