KEGG   Pongo abelii (Sumatran orangutan): 100448382
Entry
100448382         CDS       T01416                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04015  Rap1 signaling pathway
pon04218  Cellular senescence
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04935  Growth hormone synthesis, secretion and action
pon05014  Amyotrophic lateral sclerosis
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05145  Toxoplasmosis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448382 (MAP2K6)
   04015 Rap1 signaling pathway
    100448382 (MAP2K6)
   04668 TNF signaling pathway
    100448382 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100448382 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100448382 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100448382 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100448382 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    100448382 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100448382 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100448382 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100448382 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100448382 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    100448382 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100448382 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100448382 (MAP2K6)
   05135 Yersinia infection
    100448382 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100448382 (MAP2K6)
   05161 Hepatitis B
    100448382 (MAP2K6)
   05163 Human cytomegalovirus infection
    100448382 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100448382 (MAP2K6)
   05169 Epstein-Barr virus infection
    100448382 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100448382 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100448382 (MAP2K6)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100448382 (MAP2K6)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE7 family
   100448382 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 100448382
NCBI-ProteinID: XP_002827807
Ensembl: ENSPPYG00000008579
UniProt: H2NUJ7 A0A6D2XRY6
LinkDB
Position
17
AA seq 334 aa
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaattccaaaagaagcattt
gaacaacctcagaccagttccacaccacctcgagatttagactccaaggcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctggagcctataatggaactggga
cgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcgggcagatcatggca
gtgaagcggatccgagctacagtaaatagccaggaacagaaacggctactgatggatttg
gatatttccatgaggacggtggactgtccattcactgtcaccttttatggcgcactgttt
cgggagggtgatgtgtggatctgcatggagctcatggatacatcactagataaattctac
aaacaagttattgataaaggccagacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcattagaacatttacacagtaagctgtctgtcattcacagagacgtc
aagccttctaatgtactcattaatgctctcggtcaagtgaagatgtgcgattttggaatc
agtggctacttggtggactctgttgctaaaacaattgatgcaggttgcaaaccatacatg
gcccctgaaagaataaacccagagctcaaccagaagggatacagtgtgaagtctgacatt
tggagtctgggcatcacaatgattgagttggccatccttcgatttccctatgattcatgg
ggaactccatttcagcagctcaaacaggtggtagaggagccatcgccacaactcccagca
gacaagttctctgcagagtttgttgactttacctcacagtgcttaaagaagaattccaaa
gaacggcctacatacccagagctaatgcaacatccatttttcaccctacatgaatccaaa
ggaacagatgtggcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system