KEGG   Pongo abelii (Sumatran orangutan): 100450307
Entry
100450307         CDS       T01416                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05219  Bladder cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100450307 (ERBB2)
   04012 ErbB signaling pathway
    100450307 (ERBB2)
   04066 HIF-1 signaling pathway
    100450307 (ERBB2)
   04020 Calcium signaling pathway
    100450307 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100450307 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100450307 (ERBB2)
   04520 Adherens junction
    100450307 (ERBB2)
   04530 Tight junction
    100450307 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450307 (ERBB2)
   05206 MicroRNAs in cancer
    100450307 (ERBB2)
   05205 Proteoglycans in cancer
    100450307 (ERBB2)
   05230 Central carbon metabolism in cancer
    100450307 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100450307 (ERBB2)
   05226 Gastric cancer
    100450307 (ERBB2)
   05219 Bladder cancer
    100450307 (ERBB2)
   05215 Prostate cancer
    100450307 (ERBB2)
   05213 Endometrial cancer
    100450307 (ERBB2)
   05224 Breast cancer
    100450307 (ERBB2)
   05223 Non-small cell lung cancer
    100450307 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100450307 (ERBB2)
   01524 Platinum drug resistance
    100450307 (ERBB2)
   01522 Endocrine resistance
    100450307 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100450307 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100450307 (ERBB2)
   04090 CD molecules [BR:pon04090]
    100450307 (ERBB2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100450307 (ERBB2)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100450307 (ERBB2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100450307 (ERBB2)
CD molecules [BR:pon04090]
 Proteins
  100450307 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 100450307
NCBI-ProteinID: XP_024090162
Ensembl: ENSPPYG00000008479
LinkDB
Position
17
AA seq 1267 aa
MARTNAVQHRDSDPDSHACAGSDESDMYCCGHAQKRVCTGTDMKLRLPASPETHLDMLRH
LYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLF
EDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIERNPQLCYQDTIL
WKDIFHKNNQLAVTLIDTNRSRACHPCSSVCKGSRCWGESSEDCQSLTRTVCAGGCARCK
GPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGR
YTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGME
HLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLRVFETLEEITG
YLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALI
HHNTRLCFVHTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQC
VNCSQFLRGQECVEECRVLQGLPREYVNARYCLPCHPECQPQNGSVTCFGPEADQCVACA
HYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRA
SPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPN
QAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEIL
DEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQ
IAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKW
MALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICT
IDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSL
LEDDDMGDLVDAEEYLVPQQGFFCPDPAPGVGGMVHHRHRSSSTRSGGGDLTLGLEPSEE
EAPRSPLAPSDGAGSDVFDGDLGMGAAKGLQSLPAHDPSPLQRYSEDPTVPLPSETDGYV
APLTCSPQPEYVNQPDVRPQPPSPREGPLPPARPAGATLERPKTLSPGKNGVVKDVFAFG
GAVENPEYLAPRGGAAPQPHPPPAFSPAFDNLYYWDQDPSERGAPPSTFKGTPTAENPEY
LGLDVPV
NT seq 3804 nt   +upstreamnt  +downstreamnt
atggccaggacaaacgcagtgcagcacagagactcagaccctgacagccatgcctgcgca
ggcagtgatgagagtgacatgtactgttgtggacacgcacaaaagcgagtgtgcaccggc
acagacatgaagctgcggctccctgccagtcccgagacccacctggacatgctccgccac
ctctaccagggctgccaggtggtgcaaggaaacctggaactcacctacctgcccaccaat
gccagcctctccttcctgcaggatatccaggaggtgcagggctacgtgctcatcgctcac
aaccaagtgaggcaggtcccactgcagaggctgcggattgtgcgaggcacccagctcttt
gaggacaactatgccctggccgtgctagacaatggagacccgctgaacaataccacccct
gtcacaggggcctccccaggaggcctgcgggagctgcagcttcgaagcctcacagagatc
ttgaaaggaggggtcttgatcgagcggaacccccagctctgctaccaggacacgattttg
tggaaggacatcttccacaagaacaaccagctggctgtcacactgatagacaccaaccgc
tctcgggcctgccacccctgttcttcggtgtgtaagggctcccgctgctggggagagagt
tctgaggattgtcagagcctgacgcgcactgtctgtgccggtggctgtgcccgctgcaag
gggccactgcccactgactgctgccatgagcagtgtgctgccggctgcacgggccccaag
cactctgactgcctggcctgcctccacttcaaccacagtggcatctgtgagctgcactgc
ccagccctggtcacctacaacacagacacctttgagtccatgcccaatcccgagggccga
tatacattcggcgccagctgtgtgactgcctgtccctacaactacctttctacggacgtg
ggatcctgcaccctcgtctgccccctgcacaaccaagaggtgacagcagaggacggaaca
cagcggtgtgagaagtgcagcaagccctgtgcccgagtgtgctatggtctgggcatggag
cacttgcgagaggtgagggcagtcaccagtgccaatatccaggagtttgctggctgcaag
aagatctttgggagcctggcatttctgccggagagctttgatggggacccagcctccaac
accgccccgctccagccagagcagctccgagtgtttgagactctggaagagatcacaggt
tacctatacatctcagcatggccagacagcctgcctgacctcagcgtcttccagaacctg
caagtaatccggggacgaattctgcacaatggcgcctactcgctgaccctgcaagggctg
ggcatcagctggctggggctgcgctcgctgcgggaactgggcagtggactggccctcatc
caccataacacccgcctctgcttcgtgcacacggtgccctgggaccagctcttccggaac
ccgcaccaagctctgctccacactgccaaccggccagaggacgagtgtgtgggcgagggc
ctggcctgccaccagctgtgcgcccgagggcactgctggggtccagggcccacccagtgt
gtcaactgcagccagttccttcggggccaggagtgcgtggaggaatgccgagtactgcag
gggctccccagggagtatgtgaatgccaggtactgtttgccgtgccaccctgagtgtcag
ccccagaatggctcagtgacctgttttggaccggaggctgaccagtgtgtggcctgtgcc
cactataaggaccctcccttctgcgtggcccgctgccccagcggtgtgaaacctgacctc
tcctacatgcccatctggaagtttccagatgaggagggcacgtgccagccttgccccatc
aactgcacccactcctgtgtggacctggatgacaagggctgccccgccgagcagagagcc
agccctctgacgtccatcatctctgcggtggtgggcattctgctggtcgtggtcttgggg
gtggtctttgggatcctcatcaagcgacggcagcagaagatccggaagtacacgatgcgg
aggctgctgcaggaaacggagctggtggagccgctgacacctagcggagcgatgcccaac
caggcgcagatgcgtatcctgaaagagacggagctgaggaaggtgaaggtgcttggatct
ggcgcttttggcacagtctacaagggcatctggatccctgatggggaaaatgtgaaaatt
ccagtggccatcaaagtgttgagggaaaacacatcccccaaagccaacaaagaaatctta
gacgaagcatacgtgatggctggtgtgggctccccatatgtctcccgcctcctgggcatc
tgcctgacatccacggtgcagctggtgacacagcttatgccctatggctgcctcttagac
catgtccgggaaaaccgcggacgcctgggctcccaggacctgctgaactggtgtatgcag
attgccaaggggatgagctacctggaggatgtgcggctcgtacacagggacttggctgct
cggaacgtgctggtcaagagtcccaaccatgtcaaaattacagacttcgggctggctcgg
ctgctggacattgacgagacagagtaccatgcagatgggggcaaggtgcccatcaagtgg
atggcgctggagtccattctccgccggcggttcacccaccagagtgatgtgtggagttat
ggtgtgactgtgtgggagctgatgacttttggggccaaaccttacgatgggatcccagcc
cgggagatccctgacctgctggaaaagggggagcggctgccccagcctcccatctgcacc
attgatgtctacatgatcatggtcaaatgttggatgattgactctgaatgtcggccgaga
ttccgggagttggtgtctgaattctcccgcatggccagggacccccagcgctttgtggtc
atccagaatgaggacttgggcccagccagtcccttggacagcaccttctaccgctcactg
ctggaggacgatgacatgggggacctggtggatgctgaggagtatctggtaccccagcag
ggcttcttctgtccagaccctgccccgggagttgggggcatggtccaccacaggcaccgc
agctcatctaccaggagtggcggtggggacctgacgctagggctggagccctctgaagag
gaggcccccaggtctccactggcaccctccgatggggctggctccgatgtatttgatggt
gacctgggaatgggggcagccaaggggctgcaaagcctccccgcacatgaccccagccct
ctacagcggtacagtgaggaccccacagtacccctgccctctgagactgatggctacgtt
gcccccctgacctgcagcccccagcccgaatatgtgaaccagccagatgttcggccacag
cctccttcgccccgagagggccctctgcctcctgcccgacctgctggtgccactctggaa
aggcctaagactctctccccagggaagaatggggttgtcaaagacgtttttgcctttggg
ggtgccgtggagaaccccgagtacttggcaccccggggaggagctgcccctcagccccac
cctcctcctgccttcagcccagccttcgacaacctctattactgggaccaggacccatca
gagcggggggctccacccagcaccttcaaagggacacctacggcagaaaacccagagtac
ctgggtctggacgtgccagtgtga

DBGET integrated database retrieval system