KEGG   Pongo abelii (Sumatran orangutan): 100450314
Entry
100450314         CDS       T01416                                 

Gene name
CISH
Definition
(RefSeq) cytokine-inducible SH2-containing protein isoform X2
  KO
K04701  cytokine inducible SH2-containing protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
pon04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100450314 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100450314 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100450314 (CISH)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100450314 (CISH)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100450314 (CISH)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100450314 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100450314
NCBI-ProteinID: XP_002813752
Ensembl: ENSPPYG00000013836
UniProt: H2PAM9 A0A6D2XMZ8
LinkDB
Position
3
AA seq 258 aa
MVLCVQGPRPLLAVERSGQRPLWAPSLELPEPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPLATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQYPFQL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtcctctgcgttcagggacctcgtcctttgctggctgtggagcggagtgggcagcgg
cccctgtgggccccgtccctggaactgcccgagccagtcatgcagcccttgcctgctggg
gccttcctcgaggaggtggcagagggtaccccagcccagacagagagtgagccaaaggtg
ctggacccagaggaggatctgctgtgcatagccaagaccttctcctaccttcgggaatct
ggctggtattggggttccattacggccagcgaggcccggcaacacctgcagaagatgcca
gaaggcacattcttagtacgtgacagcacccaccccagctacctgttcacgctgtcagtg
aaaaccactcgtggccccaccaatgtgcgcattgagtatgccgactccagcttccgtctg
gactccaactgcttgtccaggccacgcatcctggcctttccggatgtggtcagccttgtg
cagcactatgtggcctcctgcactgctgatacccgaagcgacagccctgatcctgctccc
actccggccctgcctatgcctaaggaggatgcgcctagtgacccagcactgcctgctcct
ccactagccactgctgtacacctaaaactggtgcagccctttgtacgcagaagcagtgcc
cgcagcctgcaacacctgtgccgccttgtcatcaaccgtctggtggccgacgtggactgc
ctgccactgccccggcgcatggccgactacctccggcagtaccccttccagctctga

DBGET integrated database retrieval system