KEGG   Pongo abelii (Sumatran orangutan): 100450864
Entry
100450864         CDS       T01416                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1 isoform X2
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04068  FoxO signaling pathway
pon04144  Endocytosis
pon04218  Cellular senescence
pon04350  TGF-beta signaling pathway
pon04371  Apelin signaling pathway
pon04380  Osteoclast differentiation
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04659  Th17 cell differentiation
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05142  Chagas disease
pon05161  Hepatitis B
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05220  Chronic myeloid leukemia
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100450864 (TGFBR1)
   04350 TGF-beta signaling pathway
    100450864 (TGFBR1)
   04390 Hippo signaling pathway
    100450864 (TGFBR1)
   04371 Apelin signaling pathway
    100450864 (TGFBR1)
   04068 FoxO signaling pathway
    100450864 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100450864 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100450864 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    100450864 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100450864 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100450864 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100450864 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100450864 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450864 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100450864 (TGFBR1)
   05212 Pancreatic cancer
    100450864 (TGFBR1)
   05225 Hepatocellular carcinoma
    100450864 (TGFBR1)
   05226 Gastric cancer
    100450864 (TGFBR1)
   05220 Chronic myeloid leukemia
    100450864 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100450864 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100450864 (TGFBR1)
   05161 Hepatitis B
    100450864 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100450864 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100450864 (TGFBR1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100450864 (TGFBR1)
Protein kinases [BR:pon01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100450864 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 100450864
NCBI-ProteinID: XP_009242963
Ensembl: ENSPPYG00000019439
UniProt: A0A663DA69 H2PSV9
LinkDB
Position
9
AA seq 503 aa
MEAAAAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggaggcggcggccgctgctccgcgtccccggctgctcctcctcgtgctggcggcggcg
gcggcggcggcggcggcgctgctcccgggggcgacggcgttacagtgtttctgccacctc
tgtacaaaagacaattttacttgtgtgacagatgggctctgctttgtctctgtcacagag
accacagacaaagttatacacaacagcatgtgtatagctgaaattgacttaattcctcga
gataggccgtttgtatgtgcaccctcttcaaaaactgggtctgtgactacaacatattgc
tgcaatcaggaccattgcaataaaatagaacttccaactactgtaaagtcatcacctggc
cttggtcctgtggaactggcagctgtcattgctggaccagtgtgcttcgtctgcatctca
ctcatgttgatggtctatatctgccacaaccgcactgtcattcaccatcgagtgccaaat
gaagaggacccttcattagatcgcccttttatttcagagggtactacgttgaaagactta
atttatgatatgacaacgtcaggttctggctcaggtttaccattgcttgttcagagaaca
attgcgagaactattgtgttacaagaaagcattggcaaaggtcgatttggagaagtttgg
agaggaaagtggcggggagaagaagttgctgttaagatattctcctctagagaagaacgt
tcgtggttccgtgaggcagagatttatcaaactgtaatgttacgtcatgaaaacatcctg
ggatttatagcagcagacaataaagacaatggtacttggactcagctctggttggtgtca
gattatcatgagcatggatccctttttgattacttaaacagatacacagttactgtggaa
ggaatgataaaacttgctctgtctacggcgagcggtcttgcccatcttcacatggagatt
gttggtacccaaggaaagccagccattgctcatagagatttgaaatcaaagaatatcttg
gtaaagaagaatggaacttgctgtattgcagacttaggactggcagtaagacatgattca
gccacagataccattgatattgctccaaaccacagagtgggaacaaaaaggtacatggcc
cctgaagttctcgatgattccataaatatgaaacattttgaatccttcaaacgtgctgac
atctatgcaatgggcttagtattctgggaaattgctcgacgatgttccattggtggaatt
catgaagattaccaactgccttattatgatcttgtaccttctgacccatcagttgaagaa
atgagaaaagttgtttgtgaacagaagttaaggccaaatatcccaaacagatggcagagc
tgtgaagccttgagagtaatggctaaaattatgagagaatgttggtatgccaatggagca
gctaggcttacagcattgcggattaagaaaacattatcacaactcagtcaacaggaaggc
atcaaaatgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100459236
Entry
100459236         CDS       T01416                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04068  FoxO signaling pathway
pon04144  Endocytosis
pon04218  Cellular senescence
pon04350  TGF-beta signaling pathway
pon04380  Osteoclast differentiation
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04659  Th17 cell differentiation
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05142  Chagas disease
pon05161  Hepatitis B
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05220  Chronic myeloid leukemia
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459236 (TGFBR2)
   04350 TGF-beta signaling pathway
    100459236 (TGFBR2)
   04390 Hippo signaling pathway
    100459236 (TGFBR2)
   04068 FoxO signaling pathway
    100459236 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100459236 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100459236 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    100459236 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100459236 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100459236 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100459236 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100459236 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459236 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    100459236 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100459236 (TGFBR2)
   05212 Pancreatic cancer
    100459236 (TGFBR2)
   05225 Hepatocellular carcinoma
    100459236 (TGFBR2)
   05226 Gastric cancer
    100459236 (TGFBR2)
   05220 Chronic myeloid leukemia
    100459236 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100459236 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100459236 (TGFBR2)
   05161 Hepatitis B
    100459236 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100459236 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100459236 (TGFBR2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100459236 (TGFBR2)
Protein kinases [BR:pon01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100459236 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100459236
NCBI-ProteinID: XP_002814024
Ensembl: ENSPPYG00000014049
UniProt: A0A6D2WRM0 H2PBA1
LinkDB
Position
3
AA seq 592 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRTAHPLRHINND
MMVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENI
TLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNT
SNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSSWETGKTRKLMEFSEH
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCE
TLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggatgtggaaatggaggcccagaaagat
gaaatcatctgccccagctgtaataggactgcccatccactgagacatattaataatgac
atgatggtcactgacaacaatggtgcagtcaagtttccacaactgtgtaaattttgtgat
gtgagattttccacctgtgacaaccagaaatcctgcatgagcaactgcagcatcacctcc
atctgtgagaagccacaggaagtctgtgtggctgtatggagaaagaatgatgagaacata
acactagagacagtttgccatgaccccaagctgccctaccatgactttattctggaagat
gctgcttctccaaagtgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatg
tgttcctgtagctctgatgagtgcaatgacaacatcatcttctcagaagaatataacacc
agcaatcctgacttgttgctagtcatatttcaagtgacaggcatcagcctcctgccacca
ctgggagttgccatatctgtcatcatcatcttctactgctaccgcgttaaccggcagcag
aagctgagttcatcctgggaaaccggcaagacgcggaagctcatggagttcagtgagcac
tgtgccatcatcctggaagacgaccgctctgacatcagctccacgtgcgccaacaacatc
aaccacaacacagagctgctgcccattgagctggacacgctggtggggaaaggtcgcttt
gctgaggtctataaggccaagctgaagcagaacacttcagagcagtttgagacagtggca
gtcaagatctttccctatgaggagtatgcctcttggaagacagagaaggacatcttctca
gacatcaacctgaagcatgagaacatactccagttcctgacggctgaggagcggaagacg
gagttggggaaacagtactggctgatcaccgctttccacgccaagggcaacctacaggag
tacctgacacggcatgtcatcagctgggaggacctgcgcaagctgggcagctccctcgcc
cgggggattgctcacctccacagtgatcacactccatgtgggaggcccaagatgcccatc
gtgcacagggacctcaagagctccaatatcctcgtgaagaacgacctaacctgctgcctg
tgtgactttgggctttccctgcgtctggaccctactctgtctgtggatgacctggctaac
agtgggcaggtgggaactgcaagatacatggctccagaagtcctagaatccaggatgaat
ttggagaatgttgagtccttcaagcagaccgatgtctactccatggctctggtgctctgg
gaaatgacatctcgttgtaatgcagtgggagaagtaaaagattatgagcctccatttggt
tccaaggtgcgggagcacccctgtgtggaaagcatgaaggacaacgtgttgagagatcga
gggcgaccagaaattcccagcttctggctcaaccaccagggcatccagatggtgtgtgag
acgttgactgagtgctgggaccacgacccagaggcccgtctcacagcccagtgtgtggca
gaacgcttcagtgagctggagcatctggacaggctctcggggaggagctgctcggaggag
aagattcctgaagacggctccctaaacactaccaagtag

DBGET integrated database retrieval system