KEGG   Pongo abelii (Sumatran orangutan): 100452463
Entry
100452463         CDS       T01416                                 

Gene name
ABCB1
Definition
(RefSeq) multidrug resistance protein 1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon02010  ABC transporters
pon04976  Bile secretion
pon05206  MicroRNAs in cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100452463 (ABCB1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100452463 (ABCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100452463 (ABCB1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100452463 (ABCB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100452463 (ABCB1)
   04147 Exosome [BR:pon04147]
    100452463 (ABCB1)
   04090 CD molecules [BR:pon04090]
    100452463 (ABCB1)
Enzymes [BR:pon01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     100452463 (ABCB1)
Transporters [BR:pon02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    100452463 (ABCB1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100452463 (ABCB1)
CD molecules [BR:pon04090]
 Proteins
  100452463 (ABCB1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 AAA_22 RsgA_GTPase Rad17 Zeta_toxin G-alpha AAA AAA_5 AAA_29 AAA_7 AAA_14 APS_kinase PRK DUF815 AAA_15 AAA_30 AAA_24 NTPase_1 DUF2207
Other DBs
NCBI-GeneID: 100452463
NCBI-ProteinID: XP_024105421
Ensembl: ENSPPYG00000017843
LinkDB
Position
7
AA seq 1280 aa
MDLEGDRNGGAEKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDTFANAGNLEDLLSNITNKSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIYKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPIIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATSIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSGS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAVIFSKIIGVFTRNDDPETKRQNSNLFSVLFLVLGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGAGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHRLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLKPNTLEGNVTFSEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVMAAKEANIHAFIESLPNKYSTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGAKRQ
NT seq 3843 nt   +upstreamnt  +downstreamnt
atggatcttgaaggggaccgcaatggaggagcagagaagaagaacttttttaaattgaac
aataaaagtgaaaaagataagaaggaaaagaaaccaactgtcagtgtattttcaatgttt
cgctattcaaattggcttgacaagttgtatatggtggtgggaactttggctgccatcatc
catggggctggacttcctctcatgatgctggtgtttggagaaatgacagatacctttgca
aatgcaggaaatttagaagatctgttgtcaaacatcactaataaaagtgatatcaatgat
acagggttcttcatgaatctggaggaagacatgaccaggtatgcctattattacagtgga
attggtgctggggtgctggttgctgcttacattcaagtttcattctggtgcctggcagct
ggaagacaaatatacaaaattagaaaacagttttttcatgctataatgcgacaggagatc
ggctggtttgatgtgcatgatgttggggagcttaacacccgacttacagatgacgtctcc
aagattaatgaaggaattggtgacaaaattggaatgttctttcagtcaatggcaacattt
ttcactgggtttatagtaggatttacacgtggttggaagctaacccttgtgattttggcc
atcagtcctgttcttggactgtcagctgctgtctgggcaaagatactatcttcatttact
gataaagaactcttagcttatgcaaaagctggagcagtagctgaggaggtcttggcagca
attagaactgtgattgcatttggaggacaaaagaaagaacttgaaaggtacaacaaaaat
ttagaagaagctaaaagaattgggataaagaaagctattacagccaatatttctataggt
gctgctttcctgctgatctatgcatcttatgctctggccttctggtatgggactaccttg
gtcctctcaggggaatattctattggacaagtactcactgtattcttttctgtattaatt
ggggcttttagtgttggacaggcatctccaagcattgaagcatttgcaaatgcaagagga
gcagcttatgaaatcttcaagataattgataataagccaattattgacagctattcgaag
agtgggcacaaaccagataatattaagggaaatttggaattcagaaatgttcacttcagt
tacccatctcgaaaagaagttaagatcttgaagggcctgaacctgaaggtgcagagtggg
cagacggtggccctggttggaaacagtggctgtgggaagagcacaacggtccagctgatg
cagaggctctatgaccccacagaggggatggtcagtgttgatggacaggatattaggacc
ataaacgtaaggtttctacgggaaatcatcggtgtggtgagtcaggaacctgtattgttt
gccacctcaatagctgaaaacattcgctatggccgtgaaaatgtcaccatggatgagatt
gagaaagctgtcaaggaagccaatgcctatgattttatcatgaaactgcctcataaattt
gacaccctggttggagagagaggggcccagctgagtggtgggcagaagcagaggatcgcc
attgcacgtgccctggttcgcaaccccaagatcctcctgctggacgaggccacgtcagcc
ttggacacagaaagtgaagcagtggttcaggtggctctggataaggccagaaaaggtcgg
accaccattgtgatagctcatcgtttgtctacagttcgtaatgctgacgtcatcgctggt
tttgatgatggagtcattgtggagaaaggaaatcatgatgaactcatgaaagagaaaggc
atttacttcaaacttgtcacaatgcagacagcaggaaatgaagttgaattagaaaatgca
gctgatgaatccaaaagtgaaattgatgccttggaaatgtcttcaaatgattcaggatcc
agtctaataagaaaaagatcaactcgtaggagtgtccgtggatcacaagcccaagacaga
aagcttagtaccaaagaggctctggatgaaagtatacctccagtttccttttggaggatt
atgaagctaaatttaactgaatggccttattttgttgttggtgtattttgtgccattata
aacggaggcctgcaaccagcatttgcagtaatattttcaaagattataggggtttttaca
agaaatgatgatcctgaaacaaaacgacagaatagtaacttgttttcagtattgtttcta
gtccttggaattatttcttttattacatttttccttcagggtttcacatttggcaaagct
ggagagatcctcaccaagcggctccgatacatggttttccgatccatgctcagacaggat
gtgagctggtttgatgaccctaaaaacaccactggagcattgactaccaggctcgccaat
gatgctgctcaagttaaaggggctataggttccaggcttgctgtaattacccagaatata
gcaaatcttgggacaggaataattatatctttcatctatggttggcaactaacactgtta
cttttagcaattgtacccatcattgcaatagcaggagttgttgaaatgaaaatgttgtct
ggacaagcactgaaagataagaaagaactagaaggtgctgggaagatcgctactgaagca
atagaaaacttccgaaccgttgtttctttgactcaggagcagaagtttgaacatatgtat
gctcagagtttgcaggtaccatacagaaactctttgaggaaagcacacatctttggaatt
acgttttccttcacccaggcaatgatgtatttttcctatgctggatgtttccggtttgga
gcctacttggtggcacatagactcatgagctttgaggatgttctgttagtattttcagct
gttgtctttggtgccatggccgtggggcaagtcagttcatttgctcctgactatgccaaa
gccaaaatatcagcagcccacatcatcatgatcattgaaaaaacccctttgattgacagc
tacagcacagaaggcctaaagccgaacacattggaaggaaatgtcacatttagtgaagtt
gtattcaactatcccacccgaccggacatcccagtgcttcagggactgagcctggaggtg
aagaagggccagacgctggccctggtgggcagcagtggctgtgggaagagcacggtggtc
cagctcctggagcggttctacgaccccttggcagggaaagtgctgcttgatggcaaagaa
ataaagcgactgaatgttcagtggctccgagcacacctgggcatcgtgtcccaggagccc
atcctgtttgactgcagcattgccgagaacattgcctatggagacaacagccgggtggtg
tcacaggaagagattgtgatggcagccaaggaagccaacatacatgccttcatcgagtca
ctgcctaataaatatagcactagagtaggagacaaaggaactcagctctctggtggccag
aaacaacgcattgccatagctcgtgcccttgttagacagcctcatattttgcttttggat
gaagccacatcagctctggatacagaaagtgaaaaggttgtccaagaagccctggacaaa
gccagagaaggccgcacctgcattgtgattgctcaccgcctgtccaccatccagaatgca
gacttaatagtggtgtttcagaatgggagagtcaaggagcatggcacgcatcagcagctg
ctggcacagaaaggcatctatttttcaatggtcagtgtccaggctggagcaaagcgccag
tga

DBGET integrated database retrieval system