KEGG   Pongo abelii (Sumatran orangutan): 100453085
Entry
100453085         CDS       T01416                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04022  cGMP-PKG signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04371  Apelin signaling pathway
pon04611  Platelet activation
pon04725  Cholinergic synapse
pon04921  Oxytocin signaling pathway
pon05132  Salmonella infection
pon05145  Toxoplasmosis
pon05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100453085 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100453085 (PIK3CG)
   04072 Phospholipase D signaling pathway
    100453085 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    100453085 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    100453085 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100453085 (PIK3CG)
   04062 Chemokine signaling pathway
    100453085 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100453085 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100453085 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    100453085 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100453085 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100453085 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100453085 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100453085 (PIK3CG)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100453085 (PIK3CG)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100453085 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 100453085
NCBI-ProteinID: XP_002818380
Ensembl: ENSPPYG00000017896
UniProt: H2PN59
LinkDB
Position
7
AA seq 1102 aa
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKATHRSPGQIHLVQRRPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
VTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
PGTILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGEAPIKNFQWVRHCLKNG
EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
VLHMWQISGKGEDQGSFSADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
KSFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctggaaaactataaacagcccgtggtgctgagagaggacaactgccgcaggcgc
cggaggatgaagccgcgcagtgctgcagccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccaccagccagcgcaaatgcaagagccccgaaacggcgctgctgcac
gtggcgggccacggcaacgtggagcagatgaaggcccaggtgtggctgcgagctctggag
accagcgtggcagcggacttctaccaccggctgggccctgaccacttcctcctgctctat
cagaagaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagactctggac
tgcctgcgctactggaaggccacacaccggagcccgggccagatccacctggtgcagcgg
cgcccgccctccgaagagtcgcaagccttccagcggcagctcaccgcgctgattggctat
gacgtcactgacgtcagcaacgtgcacgacgacgagctggagttcacgcgccgtggcttg
gtgaccccgcgcatggcggaggtggccagccgcgaccccaagctctacgccatgcacccg
tgggtgacgtccaagcccctcccggagtacctgtggaagaagattgccaacaactgcatc
ttcatcgtcattcaccgcagcaccaccagccagaccattaaggtctcgcccgacgacacc
cccggcaccatcctgcagagcttcttcaccaagatggccaagaagaaatctctgatggat
attcccgaaagccaaagcgaacaggattttgtgctgcgcgtctgtggccgggatgagtac
ctggtgggcgaagcgcccatcaaaaacttccagtgggtgaggcactgcctcaagaacgga
gaagagattcacgtggtactggacacgcctccagacccggccctagacgaggtgaggaag
gaagagtggccgctggtggacgactgcacgggagtcaccggctaccatgagcagcttacc
atccacggcaaggaccacgagagtgtgttcaccgtgtccctgtgggactgcgaccgcaag
ttcagagtcaagatcagaggcattgatatccccgtcctgccccggaacaccgacctcaca
gtttttgtagaggcaaacatccagcatgggcaacaagtcctttgccaaaggagaaccagc
cccaaacccttcacagaggaggtgctgtggaatgtgtggcttgagttcagtatcaaaatc
aaagacttgcccaaaggggctctactgaacctccagatctactgcggtaaagctccagca
ctgtccagcaaggcctctgcagagtcccccagttctgagtccaagggcaaagttcaactt
ctctattatgtgaacctgctgctgatagaccaccgtttcctcctgcgccgtggagaatac
gtcctccacatgtggcagatatccgggaagggagaagaccaaggaagcttcagtgctgac
aaactcacgtctgcaactaacccagacaaggagaactcaatgtccatctccattcttctg
gacaattactgccacccgatagccctgcctaagcatcagcccacccctgacccggaaggg
gaccgggttcgagcagaaatgcccaaccagcttcgcaagcaattggaggcgatcatagcc
actgatccacttaaccctctcacagcagaggacaaagaattgctctggcattttagatat
gaaagccttaagcacccaaaagcatatcctaagctatttagttcagtgaaatggggacag
caagaaattgtggccaaaacataccaattgttggccagaagggaagtctgggatcaaagt
gctttggatgttgggttaacaatgcaactcctggactgcaacttctcagatgaaaatgta
agagccattgcagttcagaaactggagagcttggaggacgatgatgttctgcattacctt
ctacaattggtccaggctgtgaaatttgaaccataccatgatagcgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcactttttgttttggttcttgaga
agtgagatagcccagtccagacactatcagcagaggttcgctgtgattctggaagcctat
ttgaggggctgtggcacagccatgctgcacgactttacccaacaagtccaagtaatcgag
atgttacaaaaagtcacccttgatattaaatcgctctctgctgaaaagtatgacgtcagt
tcccaagttatttcacaacttaaacaaaagcttgaaaacctgcagaattctcaactcccc
aaaagctttagagttccatatgatcctggactgaaagcaggagcgctggcaattgaaaaa
tgtaaagtaatggcctccaagaaaaaaccactgtggcttgagtttaaatgtgctgatcct
acagccctatcaaatgaaacaattggaattatctttaaacacggtgatgatctgcgccaa
gacatgcttattttacagattctacgaatcatggagtctatttgggagactgaatctttg
gatctgtgcctcctgccatatggttgcatttcaactggtgacaaaataggaatgatcgag
attgtgaaagacgccacgacaatcgccaaaatccagcaaagcacagtgggcaacacggga
gcatttaaagatgaagtcctgaatcactggctcaaagaaaaatcccctactgaagaaaag
tttcaggcagcagtggagagatttgtttattcctgtgcaggctactgtgtggcaaccttt
gttcttggaataggcgacagacacaatgacaatattatgatcaccgagacaggaaaccta
tttcatattgacttcgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctaacccctgacttcctctttgtgatgggaacttctggaaag
aagacaagcccacacttccagaaatttcaggacatctgtgtcaaggcttatctagccctt
cgtcatcacacaaacctactgatcatcctgttctccatgatgctgatgacgggaatgcct
cagttaacaagcaaagaagacattgaatatatccgggatgccctcacagtggggaaaaat
gaggaggatgctaaaaagtattttcttgatcagattgaagtttgcagagacaaaggatgg
actgtgcagtttaattggtttctacatcttgttcttggcatcaaacaaggagagaaacat
tcagcctaa

KEGG   Pongo abelii (Sumatran orangutan): 100455593
Entry
100455593         CDS       T01416                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5 isoform X2
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04371  Apelin signaling pathway
pon04611  Platelet activation
pon04725  Cholinergic synapse
pon04921  Oxytocin signaling pathway
pon05145  Toxoplasmosis
pon05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100455593 (PIK3R5)
   04072 Phospholipase D signaling pathway
    100455593 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    100455593 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    100455593 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100455593 (PIK3R5)
   04062 Chemokine signaling pathway
    100455593 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100455593 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100455593 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    100455593 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100455593 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100455593 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100455593 (PIK3R5)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100455593 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101 DUF2284 ApoC-I
Other DBs
NCBI-GeneID: 100455593
NCBI-ProteinID: XP_009249562
Ensembl: ENSPPYG00000007968
LinkDB
Position
17
AA seq 494 aa
MDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQKFIRIYKLFKSTSQLVLRRDSRSLEGS
SDTALPLRRAGSLCSPLDEPVSPPSRAQRSCSLPQPKLGTQLPSWLLAPASRPQRRRPFL
SGDEDSKASTLRVVVFGSDRISGKVARAYSNLRRLENNCPLLARFFKLQFFYVPVKRSHG
TSPGACPPPRSQTPSPPADSPRHASPGELGTTPWEESTNDISHYLGMLDPWYERNVLGLM
HLPPEVLCQQSLKAEAQALEGTPTQLPILADMLLYYCRFAARPVLLQVYQTELTFITGEK
TTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSN
LEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQ
IIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSNLCSPPQTPPDLPAQAAPDLCS
LLCLPIMTFSGALP
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggacagcggctatgtggaggacagcgaggagagctcctccgagtggccctggaggcgt
ggcagccaggaacgccgaggccaccgcaggcctgggcagaagttcatcaggatctataaa
ctcttcaagagcaccagccagctggtactgcggagggactctcggagcctggagggcagc
tcggacacggccctgcccctgaggcgggcagggagcctctgcagccccctggacgaacca
gtatcgcccccttcccgggcccagcgctcctgctccctgccccagcccaaacttggtacc
cagctgcccagctggcttctggcccccgcttcacgcccccagcgccgccgccccttcctg
agtggagatgaggattccaaggcttccacgctacgtgttgtggtctttggctctgatcgg
atttcagggaaggtggcccgggcgtatagcaaccttcggcggctggagaacaattgccca
ctcctcgcacggttcttcaaacttcagttcttctacgtgcctgtgaagcgaagtcacggg
accagccctggtgcctgtccaccccctcggagccagacgccctcacccccggcagactcc
cctaggcacgccagccctggagagctgggcaccaccccatgggaggagagcaccaatgac
atctcccactacctcggcatgctggacccctggtatgagcgcaatgtactgggcctcatg
cacctgccccctgaagtcctgtgccagcagtccctgaaggctgaagcccaggccctggag
ggcacccccacccagctgcccatcctggccgacatgctactatactactgccgctttgcc
gccagaccggtgctgctgcaagtctatcagaccgagctgaccttcatcactggggagaag
acgacagagatcttcatccactccttggagctgggtcactccgctgccacacgtgccatc
aaggcgtcgggtcctggcagcaagcggctgggcatcgatggcgaccgggaggctgttcct
ctaacactacagattatttacagcaagggggccatcagtggacgaagccgctggagcaac
ctggagaaggtctgtacctccgtgaacctcaacaaggcctgccggaagcaggaggagctg
gattccagcatggaggccctgacgctaaacctgacagaagtggtaaaaaggcagaactcc
aaatccaagaagggctttaaccagattagcacatcgcagatcaaagtggacaaggtgcag
atcatcggctccaacagctgcccctttgctgtatgcctggaccaggatgagagaaagatc
ctgcagagtgtagtcagatgtgaggtctcaccatgctacaagccggagaagagcaacctc
tgctcgccaccccagacgcctcctgacctgccggcccaggccgcgcctgatctctgctcc
cttctctgcctgcccatcatgactttcagtggagctctgccctag

KEGG   Pongo abelii (Sumatran orangutan): 100455956
Entry
100455956         CDS       T01416                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04371  Apelin signaling pathway
pon04611  Platelet activation
pon04725  Cholinergic synapse
pon04921  Oxytocin signaling pathway
pon05145  Toxoplasmosis
pon05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100455956 (PIK3R6)
   04072 Phospholipase D signaling pathway
    100455956 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    100455956 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    100455956 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100455956 (PIK3R6)
   04062 Chemokine signaling pathway
    100455956 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100455956 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100455956 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    100455956 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100455956 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100455956 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100455956 (PIK3R6)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100455956 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 100455956
NCBI-ProteinID: XP_024091055
LinkDB
Position
17
AA seq 754 aa
MESSDVELDLQRSVQAVLRELSTQAPALQSNQGMWRWSLHKKVERDPGKSPALVRILLRE
LEKAESQDLRHVIIPLLHTVMYVLTKATGITEELYQRIYAFCTRLLTLPTPYCTVALDCA
IRLKTETAVPGTLYQRMVIAEQNLMNELYPYQERVFLFVDPELVSASVCSALLLEIEAAQ
AQQTPEACMRHVVSHALQAALGEACHAGALHRKLQDSPRRTLEHYFHAVVAAVEQMASKA
SPSREGHVERLEEIYCSLLGPVAGRCGGDLVQERPPSIPLPSPYITFHLWTGEEQLWKEL
VLFLRPRSQLRLSADLEVLDLQGLRPDRELARVSVLSTDSGIERDLPTGADEPPAPSSPE
IERAGLQRKGGIKKRAWPLDFLMPGSWDGPPGLHRRTGRPGGDGEMLPGVSRLHTARVLV
LGDDRMLGRLAQAYHRLRKRETQKFCLTPRLSLQLYYIPVLAPEKPAASRQPELGELATF
LGRVDPWYQSNVNTLCPAIHKLAEMPPSLDTSRTVDPFILDVITYYVRMGTQPIYFQIYT
VKIFFSDLSQDPTEDIFLIELKVKIQDSKFPKDGFSPRRRGVAESPGAELSLCYQKALLS
HRPREVTVSLRATGLVLKAIPASDTEVSGSRHCPLPAAPVTDHTCLNVNVTEVVKSSNLA
GKSFSTVTNTFRTNNIQIQSQDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSR
APWLNLHGQQEMEAIKAKPKPLLMPINTFSGIVQ
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggagctggacctccagaggagcgtgcaggctgtgctccgggag
ctcagcacccaggcccctgccctgcagagcaaccaaggcatgtggaggtggtccctgcac
aagaaggtcgagcgagatcctggtaagagcccggcgctggtccgcattcttctcagagaa
ctggagaaggcggaaagccaggacctccggcatgtcatcattcccttgctgcacactgta
atgtacgtgctcaccaaggccacaggaatcacagaggagctctaccagagaatctatgcc
ttttgcacaagattactgaccctgcctaccccctactgcacggtcgccttggactgcgcg
ataaggctgaaaacggagacggccgtcccagggacactgtaccaaaggatggtcattgct
gaacagaacttgatgaatgaactgtatccctaccaggagagagtgttcctctttgtggat
cctgagctggtgtctgcctctgtgtgcagtgctctactactggagatcgaggcggcccag
gcgcagcagacaccagaggcctgcatgcgccacgtggtctcccacgccctgcaggcagct
ctgggggaggcctgtcatgcaggcgctctgcacaggaagctgcaggacagccctcgccgc
accctggagcactatttccacgccgtggtggccgccgtggagcagatggccagcaaggcc
agccctagccgggagggacacgtggagaggctggaggagatttactgctcactgctgggg
cccgtggcagggcgctgcggtggtgaccttgtccaagagcggccaccaagcattcccctg
cccagcccctacatcaccttccacttgtggaccggcgaggagcagctctggaaggaactg
gtgctcttcctccgcccaagatcccagctgcgcctcagtgctgacttggaggtcttggat
ctgcagggcctccggccagaccgggagttggcccgggtttctgtgctgtccactgacagc
ggcattgagcgggaccttcccacgggggctgatgagccgcctgcacccagcagccctgag
atagagcgagccgggctgcagcgcaaagggggcatcaagaagcgtgcatggcccctggac
ttcttgatgcctggcagctgggacgggcccccagggctgcaccggaggacaggccggccc
ggtggggatggggaaatgctgcccggcgtgtcccggctgcacacagcccgggtacttgtg
ctcggagatgacaggatgctagggcgcctggcccaggcctaccacagactcaggaaacgg
gagacccagaagttctgcctcactcccagactcagcctgcagctctactacatccccgtg
ctggcgcctgagaaacctgcagcatccaggcagccggagttgggagagctggctacgttc
ctgggccgcgtagacccgtggtaccagagcaacgtcaacacgctgtgccccgccatccac
aagctggctgagatgcctccttccctggacacatcccggactgtggaccccttcatccta
gacgtcatcacctactacgtccgcatgggcacccaacccatctatttccagatctacaca
gtcaagatcttcttcagtgacctgagccaagaccctactgaagacattttcctcattgaa
ctgaaggtgaagatccaagattctaaattccccaaagatggcttttcacccaggaggaga
ggcgtggccgagagcccaggggcagagctctccctgtgctaccagaaggccttgcttagc
caccggccccgagaggtcaccgtttccctgcgggccactgggctggtcctgaaggccatt
ccagccagcgacacagaagtttcagggtctcgccattgccccctgcctgctgctcctgtc
acagaccacacgtgtctgaatgtcaacgtcacagaggttgtcaagtcctccaacttggca
ggaaagtccttctctacagtgaccaacaccttcaggacaaacaatatccagatccagagc
caggaccagaggctgctgacactgtcactggacaaggacgatcaacgcactttcagggat
gtggtcagattcgaggttgctccctgcccagaaccgtgttccggggcccagaagtccagg
gcgccgtggctcaatttgcacgggcaacaggagatggaagcaatcaaagccaagcccaag
ccccttctgatgcccatcaacacattctctggcattgtccagtga

DBGET integrated database retrieval system