KEGG   Pongo abelii (Sumatran orangutan): 100454009
Entry
100454009         CDS       T01416                                 

Gene name
IL1A
Definition
(RefSeq) interleukin-1 alpha
  KO
K04383  interleukin 1 alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04217  Necroptosis
pon04218  Cellular senescence
pon04380  Osteoclast differentiation
pon04640  Hematopoietic cell lineage
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04940  Type I diabetes mellitus
pon05010  Alzheimer disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05133  Pertussis
pon05140  Leishmaniasis
pon05152  Tuberculosis
pon05162  Measles
pon05164  Influenza A
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
pon05332  Graft-versus-host disease
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454009 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100454009 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100454009 (IL1A)
   04218 Cellular senescence
    100454009 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100454009 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100454009 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100454009 (IL1A)
   05321 Inflammatory bowel disease
    100454009 (IL1A)
   05332 Graft-versus-host disease
    100454009 (IL1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100454009 (IL1A)
   05020 Prion disease
    100454009 (IL1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100454009 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100454009 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100454009 (IL1A)
   04932 Non-alcoholic fatty liver disease
    100454009 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100454009 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100454009 (IL1A)
   05152 Tuberculosis
    100454009 (IL1A)
  09172 Infectious disease: viral
   05164 Influenza A
    100454009 (IL1A)
   05162 Measles
    100454009 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100454009 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100454009 (IL1A)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100454009 (IL1A)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 100454009
NCBI-ProteinID: XP_002811834
Ensembl: ENSPPYG00000012173
UniProt: H2P5G1
LinkDB
Position
2A
AA seq 271 aa
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSRLTFMESMVVVATNGKVLKKRRLSLSQSITDDDLQAIANGSEEEIIKPRSAPFSFLS
NVKYNFMRIIKHEFILNDALNQSIIRANDQYLTVAALHNLDEAVKFDMGAYKSSKDDAKI
TVILRISKTQLYVSAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
NLFIATKQDYWVCLAGGPPSITDFQILENQA
NT seq 816 nt   +upstreamnt  +downstreamnt
atggccaaagttccagacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa
gacagttcctccattgatcatctgtctctgaatcagaaatccttctatcatgtaagctat
ggcccactccatgaaggctgtatggatcagtctgtgtctctgagtatctctgaaacctct
aaaacatccaggcttaccttcatggagagcatggtggtagtagcgaccaacgggaaggtt
ctgaagaagagacggttgagtttaagccaatccatcactgatgatgacctgcaggccatc
gccaacggctcagaggaagaaatcatcaagcctaggtcagcacctttcagcttcctgagc
aatgtgaaatacaactttatgaggatcatcaaacacgaattcatcctgaatgatgccctc
aatcaaagtataattcgagccaatgatcagtacctcacagttgctgcattacataatctg
gatgaagcagtgaaatttgacatgggtgcttataagtcatcaaaggatgatgctaaaatt
accgtgattctaagaatctcaaaaactcaattgtatgtgagtgcccaagatgaagaccaa
ccggtgctgctgaaggagatgcctgaaatacccaaaaccatcacaggtagtgagaccaac
ctcctcttcttctgggaaactcacggcactaagaactacttcacatcagttgcccatcca
aacttgtttattgccacaaagcaagactactgggtgtgcttggcaggggggccaccctct
atcactgactttcagatactggaaaaccaggcttag

KEGG   Pongo abelii (Sumatran orangutan): 100454379
Entry
100454379         CDS       T01416                                 

Gene name
IL1B
Definition
(RefSeq) interleukin-1 beta
  KO
K04519  interleukin 1 beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01523  Antifolate resistance
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04064  NF-kappa B signaling pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04625  C-type lectin receptor signaling pathway
pon04640  Hematopoietic cell lineage
pon04657  IL-17 signaling pathway
pon04659  Th17 cell differentiation
pon04668  TNF signaling pathway
pon04750  Inflammatory mediator regulation of TRP channels
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04940  Type I diabetes mellitus
pon05010  Alzheimer disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05134  Legionellosis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05144  Malaria
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05168  Herpes simplex virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
pon05332  Graft-versus-host disease
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454379 (IL1B)
   04064 NF-kappa B signaling pathway
    100454379 (IL1B)
   04668 TNF signaling pathway
    100454379 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100454379 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100454379 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100454379 (IL1B)
   04620 Toll-like receptor signaling pathway
    100454379 (IL1B)
   04621 NOD-like receptor signaling pathway
    100454379 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    100454379 (IL1B)
   04625 C-type lectin receptor signaling pathway
    100454379 (IL1B)
   04659 Th17 cell differentiation
    100454379 (IL1B)
   04657 IL-17 signaling pathway
    100454379 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100454379 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100454379 (IL1B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100454379 (IL1B)
   05321 Inflammatory bowel disease
    100454379 (IL1B)
   05332 Graft-versus-host disease
    100454379 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100454379 (IL1B)
   05020 Prion disease
    100454379 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    100454379 (IL1B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100454379 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100454379 (IL1B)
   04932 Non-alcoholic fatty liver disease
    100454379 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100454379 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100454379 (IL1B)
   05135 Yersinia infection
    100454379 (IL1B)
   05133 Pertussis
    100454379 (IL1B)
   05134 Legionellosis
    100454379 (IL1B)
   05152 Tuberculosis
    100454379 (IL1B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100454379 (IL1B)
   05164 Influenza A
    100454379 (IL1B)
   05162 Measles
    100454379 (IL1B)
   05168 Herpes simplex virus 1 infection
    100454379 (IL1B)
   05163 Human cytomegalovirus infection
    100454379 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100454379 (IL1B)
   05144 Malaria
    100454379 (IL1B)
   05140 Leishmaniasis
    100454379 (IL1B)
   05142 Chagas disease
    100454379 (IL1B)
   05143 African trypanosomiasis
    100454379 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100454379 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100454379 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100454379 (IL1B)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100454379 (IL1B)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100454379 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 100454379
NCBI-ProteinID: XP_002811835
Ensembl: ENSPPYG00000012174
UniProt: H2P5G2
LinkDB
Position
2A
AA seq 268 aa
MAEVPELTSEMMAYYSGNEDDLFFEVDGPKQMKCSFQDLDLCPLDGGIQLRISHQHYSKG
FKQAVSVVVAMDKLRKMLVPCPQNFQDNDLSTFFPFIFEEEPIFDTWDNEAYVHDAPVRS
LNCTLRDAQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEK
NLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTS
QAENMPVFLGGTKGGQDITDFTMQFVSS
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcagaagtacctgaactcaccagtgaaatgatggcttactacagtggcaacgaggat
gacttgttctttgaagtcgatggccctaaacagatgaagtgctccttccaggacctggac
ctttgccctctggatggcggcatccagctacgaatctcccaccagcactacagcaagggc
ttcaagcaggccgtttcagttgttgtggccatggacaagctgaggaagatgctggttccc
tgcccacagaacttccaggacaatgacctgagcaccttctttcccttcatctttgaagaa
gaacctatcttcgacacatgggataacgaggcttatgtgcacgatgcacctgtacgatca
ctgaactgcacactccgggacgcacagcaaaaaagcttggtgatgtctggtccatatgaa
ctgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatgtcc
tttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaaaag
aatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagtgta
gatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagatagaa
ataaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacctct
caagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataactgac
ttcaccatgcaatttgtgtcttcctaa

DBGET integrated database retrieval system