KEGG   Pongo abelii (Sumatran orangutan): 100454097
Entry
100454097         CDS       T01416                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04140  Autophagy - animal
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04722  Neurotrophin signaling pathway
pon04910  Insulin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05165  Human papillomavirus infection
pon05168  Herpes simplex virus 1 infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100454097 (BAD)
   04014 Ras signaling pathway
    100454097 (BAD)
   04370 VEGF signaling pathway
    100454097 (BAD)
   04024 cAMP signaling pathway
    100454097 (BAD)
   04022 cGMP-PKG signaling pathway
    100454097 (BAD)
   04151 PI3K-Akt signaling pathway
    100454097 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100454097 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100454097 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100454097 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100454097 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100454097 (BAD)
   04919 Thyroid hormone signaling pathway
    100454097 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100454097 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454097 (BAD)
   05203 Viral carcinogenesis
    100454097 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100454097 (BAD)
   05212 Pancreatic cancer
    100454097 (BAD)
   05225 Hepatocellular carcinoma
    100454097 (BAD)
   05221 Acute myeloid leukemia
    100454097 (BAD)
   05220 Chronic myeloid leukemia
    100454097 (BAD)
   05218 Melanoma
    100454097 (BAD)
   05211 Renal cell carcinoma
    100454097 (BAD)
   05215 Prostate cancer
    100454097 (BAD)
   05213 Endometrial cancer
    100454097 (BAD)
   05223 Non-small cell lung cancer
    100454097 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100454097 (BAD)
   05014 Amyotrophic lateral sclerosis
    100454097 (BAD)
   05020 Prion disease
    100454097 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100454097 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100454097 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100454097 (BAD)
   05161 Hepatitis B
    100454097 (BAD)
   05160 Hepatitis C
    100454097 (BAD)
   05162 Measles
    100454097 (BAD)
   05168 Herpes simplex virus 1 infection
    100454097 (BAD)
   05165 Human papillomavirus infection
    100454097 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100454097 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100454097 (BAD)
   01524 Platinum drug resistance
    100454097 (BAD)
   01522 Endocrine resistance
    100454097 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100454097
NCBI-ProteinID: XP_024111006
Ensembl: ENSPPYG00000003110
LinkDB
Position
11
AA seq 168 aa
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSGSSKHHRQAPGLLRDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagagg
ggcctgggccccagccccgcaggggacaggccctcaggctccagcaagcatcatcgccag
gccccaggcctcctgcgggacgccagtcaccagcaggagcagccaaccagcagcagccat
catggaggcgctggggctgtggagatccggagtcgccacagctcctaccccgcggggacg
gaggacgacgaagggatgggggaggagcccagcccctttcggggccgttcgcgctcggcg
ccccccaatctctgggcagcacagcgctatggccgcgagctccggaggatgagtgacgag
tttgtggactcctttaagaagggacttcctcgcccgaagagcgcgggcacagcaacgcag
atgcggcaaagctccagctggacgcgagtcttccaatcctggtgggatcggaacttgggc
aggggaagctccgccccctcccagtga

DBGET integrated database retrieval system