KEGG   Pongo abelii (Sumatran orangutan): 100454606
Entry
100454606         CDS       T01416                                 

Gene name
SLC45A3
Definition
(RefSeq) solute carrier family 45 member 3
  KO
K15379  solute carrier family 45, member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05202  Transcriptional misregulation in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100454606 (SLC45A3)
   05206 MicroRNAs in cancer
    100454606 (SLC45A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100454606 (SLC45A3)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   100454606 (SLC45A3)
SSDB
Motif
Pfam: MFS_1 MFS_2
Other DBs
NCBI-GeneID: 100454606
NCBI-ProteinID: XP_009236958
Ensembl: ENSPPYG00000000301
LinkDB
Position
1
AA seq 553 aa
MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
PVLGLVSVPLLGSASDHWHGRYGRRRPFIWVLSLGILLSLFLIPRAGWLAGLLCPDPRPL
ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPA
IDWDTSALAPYLGTQEECLFGLLTLIFLTCVAATLLVAEEAALGPTEPAEGLSAPSLPPH
CCPCWARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL
YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCTISLVFSLVMDRLVQRFGTRAVYLASVA
AFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDAGG
ASSEDSLMTSFLPGPKPGAPFPNGHMGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEA
RVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQ
VVFDKSDLAKYSV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggtccagaggctgtgggtgagccgcctgctgcggcaccggaaagcccagctcttgctg
gtcaacctgctaacctttggcctggaggtgtgtttggccgcaggcatcacctatgtgccg
cctctgctgctggaagtgggggtagaggagaagttcatgaccatggtgctgggcattggt
ccagtgctgggcctggtctctgtcccgctcctaggctcagccagtgatcactggcacgga
cgctatggccgccgccggcccttcatctgggtgctgtccttgggcatcctgctgagcctc
tttctcatcccaagggccggctggctggcagggctgctgtgcccggatcccaggcccctg
gagctggcactgctcatcctgggcgtggggctgctggacttctgtggccaggtgtgcttc
actccactggaggccctgctctctgacctcttccgggacccggaccactgtcgccaggcc
tactctgtctatgccttcatgatcagtcttgggggctgcctgggctacctcctgcctgcc
attgactgggacaccagtgccctggccccctacctgggcacccaggaggagtgcctcttt
ggcctgctcaccctcatcttcctcacctgcgtagcagccacactgctggtggctgaggag
gcagcgctgggccccactgagccagcagaagggctgtcggccccctccttgcctccccac
tgctgtccatgctgggcccgcttggctttccggaacctgggcgccctgcttccccgactg
caccagctgtgctgccgcatgccccgcaccctgcgccggctcttcgtggctgagctgtgc
agctggatggcactcatgaccttcacgctgttttacacggatttcgtgggcgaggggctg
taccagggcgtgcccagagctgagccgggcaccgaggcccggagacactatgatgaaggc
gttcggatgggcagtctggggctgttcctgcagtgcaccatctccctggtcttctctctg
gtcatggaccggctggtgcagcggttcggcactcgagcagtctatttggccagtgtggca
gctttccctgtggctgccggtgccacatgcctctcccacagtgtggccgtggtgacggct
tcagccgccctcaccgggttcaccttctcagccctgcagatcctgccctacacactggct
tccctctaccaccgggagaagcaggtgttcctgcccaaataccgaggggacgctggaggc
gctagcagtgaggacagcctgatgaccagcttcctgccaggccctaagcctggagctccc
ttccctaatggacacatgggtgctggaggcagtggcctgctcccgcctccgcccgcgctc
tgcggggcctctgcctgcgacgtctccgtacgtgtggtggtgggtgagcccaccgaggca
agggtggttccgggccggggcatctgcctggacctcgccatcctggatagtgccttcctg
ctgtcccaggtggccccgtccctgtttatgggctccatcgtccagctcagccagtctgtc
actgcctatatggtgtctgctgcaggcctgggtctggtcgccatttactttgctacacag
gtagtatttgacaagagcgacttggccaaatactcagtgtag

DBGET integrated database retrieval system