KEGG   Pongo abelii (Sumatran orangutan): 100457313
Entry
100457313         CDS       T01416                                 

Gene name
GPCPD1
Definition
(RefSeq) glycerophosphocholine phosphodiesterase GPCPD1 isoform X1
  KO
K18695  glycerophosphocholine phosphodiesterase GPCPD1 [EC:3.1.4.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100457313 (GPCPD1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100457313 (GPCPD1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.2  glycerophosphocholine phosphodiesterase
     100457313 (GPCPD1)
SSDB
Motif
Pfam: GDPD CBM_20 PI-PLC-X
Other DBs
NCBI-GeneID: 100457313
NCBI-ProteinID: XP_009231563
Ensembl: ENSPPYG00000010687
UniProt: H2P0Z2 A0A6D2WQR7
LinkDB
Position
20
AA seq 672 aa
MTPSQVAFEIRGSLLPGEVFAICGSCDALGNWNPQNAVALLPENDTGESMLWKATIVLSR
GVSVQYRYFKGYFLEPKTFGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNGVE
TLDSGWLTCQTEIRLRLHYSEKPPVSITKKKLKKSRFRVKLTLEGLEEDDDDRVSPTVLH
KMSNSLEISLISDNEFKCRHSQPECGYGLQPDRWTEYSIQTMEPDNLELIFDFFEEDLSE
HVVQGDALPGHVGTACLLSSTIAESGKSAGILTLPIMSRNSRKTIGKVRVDYIIIKPLPG
YSCGMKSSFSKYWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAASHGAAFVEFD
VHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKSKD
RKESVVQEENSFSENQPFPSLKMVLESLPEDVGFNIEIKWICQQRDGMWDGNLSTYFDMN
LFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSEIYPELMDLRS
RTTPIAMSFAQFENLLGINVHTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRRKLKE
LGVNGLIYDRIYDWMPEQPNIFQVEQLERLKQELPELKSCLCPTVSRFVPSSLCGESDIH
VDANGIDNVENA
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgacaccttctcaggttgcctttgaaataagaggatctcttttaccaggagaagttttt
gcaatatgtggaagctgtgatgctttgggaaactggaatcctcaaaatgctgtggctctt
cttccagagaatgacacaggtgaaagcatgttatggaaagcaaccattgtactcagtaga
ggagtatcagttcagtatcgctacttcaaagggtactttttagaaccaaagactttcggt
ggtccatgtcaagtgatagttcacaagtgggagactcatctacaaccacgatcaataacc
cctttagaaagtgaaattattattgacgatggacaatttggaatccacaatggtgttgaa
actctggattctggatggctgacatgtcagactgaaataagattacgtttgcattattct
gaaaaacctcctgtgtcaataaccaagaaaaaattaaaaaaatctagatttagggtgaag
ctgacactagaaggcctggaggaagatgacgatgatagggtatctcccactgtactccac
aaaatgtccaatagcttggagatatccttaataagcgacaatgagttcaagtgcaggcat
tcacagccggagtgtggttatggcttgcagcctgatcgttggacagagtacagcatacag
acgatggagccagataacctggaactaatctttgatttttttgaagaagatctcagtgag
cacgtagttcagggtgatgcccttcctggacacgtgggtacagcttgtctcttatcatcc
accattgctgagagtggaaagagtgctggaattcttactcttcccatcatgagcagaaat
tccaggaaaacaataggcaaagtgagagttgactatataattattaagcccttaccagga
tacagttgtggcatgaaatcttcattttccaagtattggaagccaagaataccattggat
gttggccatcgaggtgcaggaaactctacaacaactgcccagctggctaaagttcaagaa
aatactattgcttctttaagaaatgctgctagtcatggtgcagcctttgtagaatttgat
gtacacctttcaaaggactttgtgcctgtggtatatcatgatcttacctgttgtttgact
atgaaaaagaaatttgatgctgatccagttgaattatttgaaattccagtaaaagaatta
acatttgaccaactccagttgttaaagctcactcatgtgactgcactgaaatctaaggat
cggaaagaatctgtggtccaggaggaaaattccttttcagaaaatcagccatttccttct
cttaagatggttttagagtctttgccagaagatgtagggtttaacattgaaataaaatgg
atctgccaacaaagggatggaatgtgggatggtaacttatcaacatattttgacatgaat
ctgtttttggatataattttaaaaactgttttagaaaattctgggaagaggagaatagtg
ttttcttcatttgatgcagatatttgcacaatggttcggcaaaagcagaacaaatatccc
atactatttttaactcaaggaaaatctgagatttatcccgaactcatggacctcagatct
cggacaacccccattgcaatgagctttgcacagtttgaaaatctactggggataaatgta
catactgaagacttgctcagaaacccatcctatattcaagaggcaaaagctaagggacta
gtcatattctgctggggtgatgataccaatgatcctgaaaacagaaggaaattgaaggaa
cttggagttaatggtctaatttacgataggatatatgattggatgcctgaacaaccaaat
atattccaagtggagcaattggaacgcctgaagcaagaattgccagagcttaagagctgt
ttgtgtcccactgttagccgctttgttccctcatctttgtgtggggagtctgatatccat
gtggatgccaacggcattgataacgtggagaatgcttag

DBGET integrated database retrieval system