KEGG   Pongo abelii (Sumatran orangutan): 100457376
Entry
100457376         CDS       T01416                                 

Gene name
GAB2
Definition
(RefSeq) GRB2-associated-binding protein 2
  KO
K08091  GRB2-associated-binding protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04380  Osteoclast differentiation
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100457376 (GAB2)
   04072 Phospholipase D signaling pathway
    100457376 (GAB2)
   04071 Sphingolipid signaling pathway
    100457376 (GAB2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    100457376 (GAB2)
   04666 Fc gamma R-mediated phagocytosis
    100457376 (GAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100457376 (GAB2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100457376 (GAB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100457376 (GAB2)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   100457376 (GAB2)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_3 PH_2 PH_8 PH_13
Other DBs
NCBI-GeneID: 100457376
NCBI-ProteinID: XP_024110857
Ensembl: ENSPPYG00000003723
LinkDB
Position
11
AA seq 676 aa
MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQ
AEESTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHM
QPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNG
VSGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPSN
TLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQ
AETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG
RSAESMSDGVGSFLPGKMTVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSIYIPMS
PGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELP
FKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGT
NSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQE
WTDVRQSSEPSKGAKL
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgagcggcggcggcgacgtggtatgcaccggctggctgaggaaatcgcctcccgagaag
aagttgaggcgctatgcctggaagaaacgctggtttatcctgcggagtggccggatgagc
ggtgacccagatgttctggaatactacaagaacgatcactccaagaagcctctgcggatc
atcaacctgaacttctgtgagcaggtagatgcaggcctgacctttaacaagaaggagctg
caggatagttttgtgtttgacatcaagaccagcgaacgcaccttttacctggtggctgag
acagaagaggacatgaataagtgggtccagagcatctgccagatctgtggcttcaatcag
gctgaggagagcacagactccctgagaaacgtttcctcagccggtcatggcccccgctct
tctccagctgagctcagcagctctagccagcaccttctccgagagcgcaaatcctcagcc
ccatcacactccagccagccaactctgttcacgtttgaaccccctgtgtcaaaccacatg
cagcccaccttgtccaccagcgcacctcaggagtatctctacttgcaccagtgcataagc
cgaagagcagaaaatgcaaggagtgccagcttctctcagggcaccagagcctcttttctc
atgaggagtgacacagctgtacaaaaacttgcccagggcaatggacactgtgtcaacggg
gtcagtggtcaagtccatggcttctatagccttcccaagccgagccggcacaatacagaa
ttcagagacagtacctatgacctcccccgcagcctggcctcccatggccacaccaagggc
agcctcacaggctccgagacagataatgaggatgtgtacaccttcaagacgcccagcaac
accctgtgcagggagtttggggacctcctggtagacaatatggatgttccggccacccca
ctctcagcctaccagatccctaggacattcactctggacaaaaaccacaatgccatgaca
gtggccactcctggggactcagccatagctcccccaccccgcccccccaagccaagtcag
gcagaaacacctcgatggggcagtcctcagcagagaccgccaatcagtgaaaatagcaga
tctgtcgctgccaccatccccagacgcaacacactccctgcaatggacaacagccgactt
caccgagcttcttcctgtgagacctacgagtacccacagcgtggtggagagagtgcaggc
cggtctgctgaatccatgagtgatggagtcggctctttcctgccagggaaaatgactgtg
ggccgatcggacagcaccaattctgaagacaactatgtgcccatgaacccaggttcttcc
accctgttggccatggaacgagcaggtgataattcccagagcatctacatcccaatgagc
ccaggggcccatcactttgactcacttggctacccatcaacaacccttcctgtgcaccga
ggccccagcagaggaagtgagatccagccaccccctgtcaaccgcaacctcaaacctgat
cggaaagccaagccaacaccacttgacctgagaaacaacaccgtcatcgatgaactcccc
ttcaagtcacctatcaccaagtcttggtctagggccaaccacaccttcaactccagctcc
tcccagtactgccgccccatctccacccagagcatcaccagcacagactcaggagacagc
gaagagaactatgtccctatgcaaaacccagtgtctgcatctcccgttcccagtggcacg
aacagtcctgcccctaagaagagcactggcagtgttgattatctggccctggacttccag
ccgagctccccaagcccccaccgcaagccatctacttcatctgtcacttctgatgagaag
gtggactatgttcaggtggacaaggagaagacccaggccctgcagaacaccatgcaggag
tggacagacgtgcggcagtcctcggagccttccaagggcgccaagctgtga

DBGET integrated database retrieval system