KEGG   Pongo abelii (Sumatran orangutan): 100459572
Entry
100459572         CDS       T01416                                 

Gene name
SLC7A1
Definition
(RefSeq) high affinity cationic amino acid transporter 1
  KO
K13863  solute carrier family 7 (cationic amino acid transporter), member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100459572 (SLC7A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100459572 (SLC7A1)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100459572 (SLC7A1)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Other DBs
NCBI-GeneID: 100459572
NCBI-ProteinID: XP_024086601
Ensembl: ENSPPYG00000005250
LinkDB
Position
13
AA seq 629 aa
MGCKVLLNIGQQMLRRKVVDCSREETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARE
NAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILS
YIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILTGLLT
LGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEG
KPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIA
YFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSASLLGSMFPMPR
VIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAY
SLVAACVLVLRYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTI
LSPKNMEPSKISGLIVNVSTSLIAVLIITFCIVTVLGREALTKGALWAVFMLAGSALLCA
VVTGVIWRQPESKTKLSFKVPFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIY
FGYGLWHSEEASLDADQARTPDGNLDQCK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggggtgcaaagtcctgctcaacattggccagcagatgctgcggcggaaggtggtagac
tgtagccgggaggagacgcggctgtcccgctgcttgaacacttttgatctggtggccctc
ggggtgggcagcacgctgggtgctggcgtctacgtcctggctggagctgtggcccgtgag
aatgcaggccctgccattgtcatctccttcctgatcgctgcgctggcttcggtgctggct
ggcctgtgctatggcgagtttggtgctcgggtccccaagacaggctcagcttacctctac
agctatgtcaccgttggagagctctgggccttcatcaccggctggaacttaatcctctcc
tacatcatcggtacttcaagtgtagcgagggcctggagcgccaccttcgacgagctgata
ggcagacccatcggggagttctcacggacacacatgactctgaacgcccccggcgtgctg
gctgaaaaccccgacatattcgcggtgatcataattctcatcttgacaggacttttaact
cttggggtgaaagagtcggccatggtcaacaaaatattcacttgtatcaacgtcctggtc
ctgggcttcataatggtgtcaggatttgtgaaaggatcggttaaaaactggcagcttacg
gaggaggattttgggaacacgtcaggccgtctctgtttgaacaatgacacaaaagaaggg
aagcccggtgttggtggattcatgcccttcgggttctctggtgtcctgtcgggggcagcg
acttgcttctatgccttcgtgggctttgattgcatcgccaccacaggtgaagaggtgaag
aacccacagaaggccatccctgtggggatcgtggcgtccctcctgatctgcttcatcgcc
tactttggggtgtcggctgccctcacgctcatgatgccctacttctgcctggacaataac
agccccctgcccgacgcctttaagcacgtgggctgggaaggtgccaagtacgcagtggcc
gtgggctccctctgcgctctttccgccagtcttctaggttccatgtttcccatgcctcgg
gttatctatgccatggctgaggatggactgctgtttaaattcttagccaacgtcaatgat
aggaccaaaacaccaataatcgccacattagcctccggtgccgttgctgctgtgatggcc
ttcctctttgacctgaaggacttggtggacctcatgtccattggcactctcctggcttac
tcattggtggctgcctgtgtgttggtcttacggtatcagccagagcaacctaacctggta
taccagatggccagtacttctgatgagttagatccagcagaccaaaatgaattggcaagc
accaatgattcccagctgggctttttaccagaggcagagatgttctctttgaaaaccata
ctctcacccaaaaacatggagccttccaaaatctctgggctaattgtgaacgtttcaacc
agcctcatagctgttctcatcatcaccttctgcattgtgaccgtgcttggaagggaggct
ctcaccaaaggggcgctgtgggcagtctttatgctcgcagggtctgccctcctctgtgcc
gtggtcacgggcgtcatctggaggcagcccgagagcaagaccaagctctcatttaaggtt
cccttcctgccagtgctccccatcctgagcatctttgtgaacgtctatctcatgatgcag
ctggaccagggcacctgggtccggtttgccgtgtggatgctgataggtttcatcatctac
tttggctacggcctgtggcacagcgaggaggcgtccctggatgccgaccaagcaaggact
cctgacggcaacttggaccagtgcaagtga

DBGET integrated database retrieval system