KEGG   Pongo abelii (Sumatran orangutan): 100462256
Entry
100462256         CDS       T01416                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100462256
   04151 PI3K-Akt signaling pathway
    100462256
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100462256
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100462256
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100462256
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100462256
   04090 CD molecules [BR:pon04090]
    100462256
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL3 receptor family
   100462256
CD molecules [BR:pon04090]
 Proteins
  100462256
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind Tissue_fac
Other DBs
NCBI-GeneID: 100462256
NCBI-ProteinID: XP_002834754
LinkDB
Position
X
AA seq 144 aa
GKPRAGAENLTCWIHDVDFLSCSWAVGPAAPADVQYDLYLNIANRRQQYECLHYKTDARG
TRIGCRFDDISRLSSGSQSSHILVRGRSAAFSIPCTDKFVVFSQIEILTPPNMTAKCNKT
HSFMHWKMRSHFNRKFRYELQIQK
NT seq 434 nt   +upstreamnt  +downstreamnt
gtgggaagcctcgggcaggtgcggagaatctgacctgctggattcacgatgtggatttct
tgagctgcagctgggcagtaggcccagcggcccccgctgatgtccagtacgacctgtact
tgaacattgccaacaggcgtcaacagtacgagtgtcttcactacaaaacggatgctcggg
gaacacgtatcgggtgtcgtttcgatgacatctctcgactctccagcggttctcaaagtt
cccacatcctggtgaggggcaggagcgcagccttcagtatcccctgcacagataagtttg
tcgtcttttcacagattgagatattaactccacccaacatgactgcaaagtgtaataaga
cacattccttcatgcactggaaaatgagaagtcatttcaatcgcaaatttcgctatgagc
ttcagatacaaaag

DBGET integrated database retrieval system