KEGG   Populus trichocarpa (black cottonwood): 18104416Help
Entry
18104416          CDS       T01077                                 

Definition
(RefSeq) transcription factor IIIA
  KO
K09191  general transcription factor IIIA
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pop03000]
    18104416
   03021 Transcription machinery [BR:pop03021]
    18104416
Transcription factors [BR:pop03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 ubiquitous factors
    18104416
Transcription machinery [BR:pop03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIA
     18104416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 18104416
NCBI-ProteinID: XP_006376244
UniProt: U5FVV9
LinkDB All DBs
Position
13
AA seq 370 aa AA seqDB search
MAMIEEEQVEKERPVIFRDIRRYYCDYCGICRSKKSLITSHVLTHHKEEMDEESVDGDEG
KEGVKSNTCENCGASFKKPAYLIQHMQSHSLERPFKCLFDDCHASYRRKDHLTRHLLQHE
GKLFKCQIENCNREFVYPSNLKRHVRELHDESFPSCSFGGEKQYVCQEPGCGKAFRYPSK
LRKHEDSHVSLDHVEAMCLEPGCMKHFSNKECLKAHIQSSHQYINCDICGTKQLKKNIKR
HLRTHEPASDSTERIKCHFNGCQHTFSTKTNLNQHVKAVHLEHRPFLCGFPGCDMRFSYK
HVRDNHEKSGLHVYTPGDFVESDRQFRSKPRGGRKRKFPTVEMLIRKRVTPPTKLDECHP
WLHEIEREDQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatagaagaagaacaagtggagaaagaaaggccagttatattcagagatata
aggcgttattattgtgattattgtggtatttgcagatctaagaagtctcttatcacttct
cacgtcctcactcatcacaaggaggagatggacgaggaaagtgttgatggggatgaggga
aaggagggagtcaaatccaacacatgtgaaaattgcggtgctagttttaaaaagcctgcg
tatttgattcaacacatgcaaagtcattctcttgagaggccatttaagtgcttgtttgat
gattgccatgccagctatagaaggaaagatcacttaactcgccaccttctccagcatgaa
gggaaacttttcaagtgtcaaattgagaattgcaatcgtgaatttgtttacccaagcaac
ttgaaaaggcatgttagagaacttcatgatgagagttttccctcctgtagttttggaggt
gagaagcagtatgtttgccaggagccgggatgtgggaaggcattcagatacccatcaaag
ctgcgaaagcacgaggattctcatgtgagcctggaccacgtggaggcaatgtgtttagaa
ccaggctgtatgaaacatttttcaaataaggaatgcctgaaggcccacattcagtccagc
caccaatacattaactgtgatatctgtggcacaaaacagctgaaaaagaacatcaagagg
catctccgcacccatgaacctgccagtgattcaacagagagaatcaaatgccatttcaat
ggttgtcagcacacattctctactaaaacaaatcttaatcagcatgtgaaggcagtgcac
cttgaacacaggccttttttgtgtggatttccaggttgtgacatgagattctcatacaag
catgtgagagataaccatgaaaagtctggtttgcatgtctatactcctggtgattttgtg
gagtctgatcggcagttcaggtcaaagccaagaggtgggaggaagaggaaattcccaacc
gttgaaatgttgatacgcaagagagtaactccaccaactaaattggatgagtgccacccg
tggttgcatgaaattgagagagaggaccagtag

DBGET integrated database retrieval system