KEGG   Populus trichocarpa (black cottonwood): 7463320Help
Entry
7463320           CDS       T01077                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop03030  DNA replication
pop03410  Base excision repair
pop03420  Nucleotide excision repair
pop03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pop00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    7463320
   03410 Base excision repair
    7463320
   03420 Nucleotide excision repair
    7463320
   03430 Mismatch repair
    7463320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pop03032]
    7463320
   03400 DNA repair and recombination proteins [BR:pop03400]
    7463320
Enzymes [BR:pop01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     7463320
    6.5.1.6  DNA ligase (ATP or NAD+)
     7463320
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     7463320
DNA replication proteins [BR:pop03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    7463320
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     7463320
DNA repair and recombination proteins [BR:pop03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     7463320
   NER (nucleotide excision repair)
    Other NER factors
     7463320
   MMR (mismatch exicision repair)
    Other MMR factors
     7463320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 7463320
NCBI-ProteinID: XP_024464752
LinkDB All DBs
Position
9
AA seq 800 aa AA seqDB search
MLRLRPCVSIRSIYSTRHSKLLPPLIPSLFFSKSPSFLKTHTLSLNPNSTMSSSRPSAFD
ALMSNARAAASAKKKTQPQPQLKPSSPKKRKTLDHPQNPDKTLNSVQNPQTDESKKLINT
PDSSNEPKSEPNSRSDSLLKVNESNKLRVEDKNTELKSKIVLLKKKAGDFKPEMVANWEK
GERVPFIFVSLAFDLIANETGRIVITDIVCNMLRTVMDTTPEDLVAVVYLLANKVAPAHE
GVELGIGEALIIKALAEACGRKEKEVKKQYKDLGDLGLVAKASRSSQSMMRKPDPLTITK
VFNTFQQIAKESGKDSQDKKKNHIKALLVAATDCEPLYLIRLLQTKLRIGLAEQTLLAAL
GQAAVYTEEHSTPPPHIQSPLEEAAKIVKQVYSVLPVYDKIVPALLSDGVWNLPKTCSFT
PGVPVGPMLAKPTKGVSEIVTKFQDMEFSCEYKYDGERAQIHYLENGSVEIYSRNSERNT
GKFPDVVAVISRLKRPSASSFILDCELVAYDREKKKILPFQILSTRARKNVVMSDIKVNV
CIYAFDMLYLNDQPLIQKELKVRREHLYSSFEEEPGFFQFATAITSNDLEEIQKFLDTAV
DASCEGLIIKTMNKDATYEPSRRSHNWLKLKKDYMESIGDSLDLVPIGAFHGRGKRTGVY
GAFLLACYNSNNEEFQSICKIGTGFSEQVLEERSASLRSQVIPKPKSYYRFGDTIKPDVW
FEPKEVWEVKAADLTISPVHRAAIGEVDPNKGISLRFPRLVRVREDKSPEQASSSEQVAE
MYNAQKHNHQNNQDDNDDDD
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggctccgtccatgcgtctctatacgctccatttactccacgcgccactccaag
cttctccctcctctcattccctctctcttcttctctaaatccccatcatttctaaaaacc
cacactctctctctaaaccctaattccacaatgtcctcctctcgcccctccgccttcgat
gctctcatgtccaacgcacgtgccgccgcctccgctaagaaaaaaacccaaccccaaccc
caattaaaacccagctcccccaaaaaacgcaaaaccctagaccatcctcaaaaccctgat
aaaaccctcaattccgtacaaaatccccaaactgatgaatctaaaaagctaattaacact
ccagattcatcgaatgagcctaaatcagaaccaaattctaggtctgatagcttattaaaa
gtcaatgaatcgaataaactgagagttgaggataaaaatacggagttgaagagcaagatt
gtgttgttaaagaagaaagctggggattttaagccggagatggtggctaattgggagaaa
ggagagagggttccgtttatatttgtttctttggcttttgatttgatagcgaacgagaca
gggaggattgtgattactgatattgtttgtaatatgttgaggactgtaatggatactact
ccggaggatttggtggctgtggtttatttgttagctaataaggttgcccctgcgcatgag
ggagtggaacttgggattggggaagctttgattattaaggcgctggcggaggcgtgtggg
aggaaagagaaggaggttaagaagcagtataaggacttgggagatttgggccttgttgca
aaagcaagtcggtcatcccaatctatgatgcgcaagcctgatccattaacaattactaaa
gttttcaacacatttcaacagattgctaaggaatccgggaaggatagtcaagacaagaaa
aagaaccatatcaaggcacttcttgttgcagccacagactgcgagcctctgtatctaatt
cgtctgcttcagacaaagttgagaattggattggcagaacagactcttttggctgccctg
ggacaagctgctgtatatactgaagagcattctactcctcctccacacattcagtctcct
ttagaagaggctgcaaagattgttaaacaagtttactctgtgcttcctgtctatgataaa
atagtccctgctcttcttagtgatggcgtatggaatcttcccaagacatgcagcttcaca
cctggtgttccagttggacctatgctggcaaaaccaaccaaaggggtttctgagatagta
actaaatttcaggatatggaattctcctgtgaatacaagtatgatggagaacgtgcccag
atacattacttggagaatggttcggttgagatatatagtcgaaattctgagcgaaatact
ggaaaatttcctgatgttgttgctgtaatttcccgattaaagaggccctcagcaagctca
tttattctggattgtgaactagttgcgtatgatagagaaaaaaagaaaattctccccttt
cagatcctcagcacccgggcccgaaaaaatgtggtgatgagtgatatcaaggttaatgtt
tgcatatatgcctttgacatgttgtatcttaatgaccaaccacttattcagaaagaactg
aaagttcgtagagagcatctttacagttcattcgaggaagaacctggattttttcagttt
gcaactgcaataacatcaaatgatcttgaagagatacaaaaattcctcgacactgctgtt
gatgccagttgtgagggtttaatcatcaaaacaatgaataaggatgctacatatgaacct
tcaaggcgatcacataactggctgaaattgaagaaagattatatggaaagtattggagac
tcactagatctagtgcctattggtgctttccatggtcgtggaaaacgtacaggtgtctat
ggtgcttttctccttgcttgttataatagcaacaacgaagaattccagagcatatgtaaa
ataggcactggattttctgaacaagtgcttgaggaacgttctgctagtctccgttcacaa
gtgattcccaaaccaaagtcatactatagatttggagatactattaaaccagatgtgtgg
tttgaacccaaggaggtgtgggaggtgaaagcagcagacttgactattagccctgttcat
cgtgctgcaattggtgaagttgatcctaacaagggaatttcactaagatttccacgtctt
gttcgagttcgagaagacaagtctccagagcaagcctcatcatcagagcaggttgctgag
atgtataatgcccaaaagcataatcatcaaaacaatcaagatgacaatgatgatgatgat
tga

DBGET integrated database retrieval system