KEGG   Paralichthys olivaceus (Japanese flounder): 109627333
Entry
109627333         CDS       T06037                                 

Definition
(RefSeq) tuberin-like
  KO
K07207  tuberous sclerosis 2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04218  Cellular senescence
pov04910  Insulin signaling pathway
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    109627333
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109627333
  09143 Cell growth and death
   04115 p53 signaling pathway
    109627333
   04218 Cellular senescence
    109627333
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109627333
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109627333
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109627333
Protein phosphatases and associated proteins [BR:pov01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109627333
SSDB
Motif
Pfam: DUF3384 Tuberin HEAT
Other DBs
NCBI-GeneID: 109627333
NCBI-ProteinID: XP_019939385
LinkDB
Position
Unknown
AA seq 794 aa
MNKQPSKESLKDKVKGIFGLGTTRPPSKQSDSKPSEFIITTDIIKELHPDCGLSNRIRMM
NHVCELAKTKKFEEHAVEAVWKAVEDMLTPEQPPEARHAVLQLLRAIIQGQGERLGPLRA
YFFKVIRDYQPCNEDLSDRLEVFKALTENGKDITYLEEDIARFVLLWMEIGLTSDFLHVL
VNLVKFNSCYLDQNVSTMVQEICFHCNRTTSSTDIEVALQVLDAVVCYNCLPSDSLTFFI
ITLCRTVNVKEFCESCWKLMRKVLGTHLGHSAIYTMCRIMEERVYMEDAPLLRGAVFFVG
MALWGAHRLPALKNTPTLVLPSFYKAMSCANEVVSYEIVLSITRLIKKYGKELQVVTWDI
LLGIIERLLQQIQTIGSAELKSIVYELLTTVEELYEQNGYHGSTEKFFSLVEKCADKRPD
ASVLTLISYRAQSIQPAKDGWIQSLHRLMEKFFRNETRSVIRIKVLHILSFVLSTNRQLY
EDELIEMVVIPQLSGIAEDRDLAVRKQATQLLVDLAEGCNTHHFTSLLDIIERVASRSLI
CSGSLEVSERDPTAESPMEDIRTAILGLLEILQSKLYSLPANHASRVYELLISHLQLHYK
NKYCSAIASSIRLQVFDFFLMMRADSLHRLGVPNKDGAMRFSPYCYCDIGEPEKRVSEKK
PTGSTSPPVGSPAPPAAPPPSTASIRSAHLPYAPAFSVLLQCLKMETDWKVLKLVLDKLP
WTLQYKVLLLTSPCSLDQLCSTLCCMVTDRLISERLKKTPEGFSRTDVQLAVVPVLTAIT
SYHNHLEQSRQRLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgaataaacaaccaagcaaggagagtctgaaggacaaggtgaaggggatctttggtcta
gggacaacgcgcccaccgagcaaacagagtgatagcaaaccatcggaatttattattacc
acagacatcatcaaggagctccatcccgactgcggcctgagcaatcgcattcgcatgatg
aaccacgtctgcgaactggcaaaaactaagaaatttgaggagcatgcagtcgaggcagta
tggaaagctgtggaggacatgctcaccccagagcagccgcctgaggccagacatgctgtc
ttgcagctgctgagggccattatacagggacagggcgagcgacttggccctctgagagcc
tactttttcaaggtgatcagagattaccaaccctgcaacgaagacctctctgaccggctg
gaagttttcaaggccttaacagaaaatggaaaagacatcacatacctggaggaggatata
gctcggtttgtcctcctgtggatggaaattggcctcacctccgactttctgcacgttctt
gtaaatctggtgaagttcaacagctgctatcttgaccagaatgtctccaccatggtccag
gaaatctgtttccattgcaacagaacaacatcgtcaacagatattgaggtagctctacaa
gtcctggatgcggtggtgtgttacaattgcctgccttcagactctctcaccttcttcatc
atcacactctgtcgtacagtcaatgtcaaggagttttgtgaatcctgctggaagctgatg
aggaaggtgttgggtactcacctcggccatagtgctatttataccatgtgtcgcatcatg
gaggagagggtatacatggaggatgcaccactgttgagaggagctgtgtttttcgttgga
atggcactgtggggcgcacacaggctccctgctctgaaaaacacacccacattggttctg
ccatctttctacaaggccatgtcgtgtgccaatgaggtggtgtcctatgaaatcgtcctt
tccatcacccgactgatcaagaagtatggaaaggagctgcaggtggtcacctgggacatc
ctgctgggcatcatagagcgactgctgcagcagatccagacaataggcagtgcagagttg
aagtccatcgtctatgagctgttgacaacagtagaggagctgtacgagcagaacggttac
catggctccacagagaagttcttcagtctggtggagaaatgtgctgacaaaagacctgat
gcatcagtgctgacacttatctcatacagggcccagtctattcagccagccaaggacggc
tggattcagagccttcaccgcctcatggagaagttcttcaggaacgagactcgcagtgtg
ataaggatcaaagtgcttcacatcctgtcctttgttctcagtaccaaccgacagctgtac
gaggatgagctgatagaaatggtggtgatcccccagctcagtgggatagctgaagaccgg
gacctggccgtcagaaagcaggccacccagctgctggtggacctggctgagggctgcaat
acgcaccacttcaccagtctgttggacatcattgaacgggttgctagtcgctctctgatt
tgttcagggtccctggaggtttctgaaagagaccccacagcagagtctcctatggaggac
atcaggactgctatactgggcttgctggaaatcctgcagagcaagctttacagtctacca
gccaaccatgccagtcgtgtttatgagctgcttatcagccacctgcagctacactataaa
aacaaatactgttcagctattgcttccagcattagactacaggtgtttgactttttcctg
atgatgcgagcagactctcttcatcgtctcggagttcccaacaaagacggggccatgagg
ttcagcccttactgctactgtgacataggggagccagagaagcgagtcagtgaaaagaag
ccaacaggttcaacatctcctcctgttggtagcccagctcccccagccgctcccccccct
tcaacagcctccatacgctcagcccacctgccctatgcacctgccttcagtgtcctcctg
cagtgcctcaagatggagacagattggaaggtgctgaagcttgttcttgataagctgccg
tggacgctgcagtacaaagtgctgctgctgacatcaccgtgcagcttggaccagctctgt
tctacactctgctgcatggtgacggatcgtctgatctcagagcgcttgaagaaaacccca
gaggggttttcccgcacggatgttcagctagcggtggttcctgtcctcacagcgatcacc
tcctatcacaaccacctggagcagtcgagacagaggttgtcctag

KEGG   Paralichthys olivaceus (Japanese flounder): 109627588
Entry
109627588         CDS       T06037                                 

Definition
(RefSeq) tuberin-like
  KO
K07207  tuberous sclerosis 2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04218  Cellular senescence
pov04910  Insulin signaling pathway
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    109627588
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109627588
  09143 Cell growth and death
   04115 p53 signaling pathway
    109627588
   04218 Cellular senescence
    109627588
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109627588
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109627588
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109627588
Protein phosphatases and associated proteins [BR:pov01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109627588
SSDB
Motif
Pfam: Rap_GAP
Other DBs
NCBI-GeneID: 109627588
NCBI-ProteinID: XP_019939768
LinkDB
Position
Unknown
AA seq 889 aa
MHTSTTTCSLGSADENAVTQADEGLKTVHLELTETCLDMMARYVFSNFSALPKRSPIAEF
LLAGGRSMTWLVGNKLVTITTSGGVRTQALLGLDMAERLGGGGEMTRSDPSLHTRITKEA
PAKLESQSSQQHSRATRIRVRSISGGHALRAGPAQSLSPLVSPSEGELAAPLSPSTGPTL
DALGPPSSSSVAPSTPPPLKDNPSLADFVPMLTQGWAEIFIRRPSGNTSWLMCLENPPSP
FSSELGNMPLQELSTVLMAMEGVKEPPAQTASAPASTAAPAPAPVSEPLTQTQSSVAGKA
NLIQRSNTESVVVLEESSVVAAAHSPSDWLESEEFEPMTSDPIFMSADKFTKTPPPGTLS
RSSSTSSQDDEKSTLEEVSEGAIPIDQPTMGPSTPGSQGPELPFQSHSKSQGHGLNKSSS
SPELQTLPEAFTKAALESETVLSDTLRPRLPSDGKPQQPQQPQQQQQQQQQQQQPQPQPQ
PHFEKDKVEVSTGGDVNGLGGAEGPGVASSQSGGARMRLEFPAAVAQPGPISPSGGHRPR
GHTISVSAPSSRRERRTERDLYHSRPGPSNTEKISGLSPSFVFLQLYHSPFFGNEANKPL
LLPKTQVIDRAVKVLDQMPPYDTHKIGVVFVGAGQVNNEVSILSNEYGSNRYAAFLTGLG
KLIHLKDCDPDQIFLGGLDQYGDDGEFTYCWHDDIMQAIFHIATLMPNRESDKGCCNKKR
HIGNDFVMVVYNDSGEDYKLGTIKGQFNFVEVIIKPLDFECNLVTLQCRKDLEGLVDTTV
AKIVSDRNLPLLVRQMALHANMASLVHQYRANPSDAYASKWLARLRHIKRIRTRAQEDIQ
SRSTPGISLTQGHTQQNKSFQQSTPAPNPETSGQRKRLVSTVDDFTDFV
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgcacacctcgaccaccacgtgcagcctcggctctgctgatgaaaatgcggtgactcag
gcagacgaggggctgaagaccgtccacctggagctcacggagacctgcctggacatgatg
gcacgatatgtgttttccaacttctccgcattgcccaagaggtcacccatagcagagttc
ttgttggcagggggtcgcagtatgacctggcttgtgggcaacaagctggtgaccataaca
accagtggaggggtccgaacacaagcattgctaggcctggacatggctgaacgtctggga
ggaggaggggaaatgaccaggtcagacccatctctacacacccgaataaccaaagaggct
ccagccaaactggagtcacagtcaagccagcagcacagcagagccacacgcatacgggtc
cgctccatctcaggaggccacgctctacgtgccggtcctgctcagagcctcagtcctctt
gtgtccccgtctgagggcgagttagctgctcccctctctccctcgaccggtcccaccctt
gatgccctgggtcctccctcctccagctcagtggccccgtcaacccccccgcctctcaaa
gacaaccccagtctggctgattttgtccccatgctcacacagggctgggcagagatcttc
atccggagaccgtctggtaacaccagctggctcatgtgtctggagaacccacccagtccc
ttttcctctgagctcggcaacatgccgcttcaggagctctccactgtcctgatggcgatg
gagggagtgaaggagcctcctgcccagactgccagcgctcccgctagcaccgctgctccc
gcaccggcaccggtctctgagcccctgacccaaacacagagcagcgtcgcagggaaggca
aacctgatccagcgctccaacactgagtctgtggtggtgctagaggaaagctcagtagtc
gctgcagcacacagcccgtctgattggctggagagtgaggagtttgagccaatgacctct
gatcccatcttcatgtctgctgacaagttcaccaagaccccgcctcctggaacactcagc
aggtcttcctccacctccagtcaagatgacgagaagtcgactcttgaggaagtaagtgag
ggagcgattcccatcgatcagcccaccatgggtccttctacacctggcagccagggaccc
gagcttcccttccagagtcattctaagtcccagggtcacggacttaacaaatctagctcc
tctccagagctccagacgttacctgaagccttcaccaaggctgctctggagtctgagaca
gtgctgtcagacacattgcggcccaggctgccctcagatggcaagcctcagcagccgcag
cagccgcagcagcagcagcagcagcagcagcagcagcagcaacctcaacctcaacctcaa
cctcattttgagaaagataaggtggaggttagcacgggaggggacgttaatggcctggga
ggcgctgaaggccctggtgtagcatcatctcagagtggaggggcaaggatgaggctggag
tttccagcagcagtggcacaacctggacccatctcccccagcggaggccaccggcccagg
ggtcacaccatctcagtatcggccccctcctccaggagggagagaaggacagagagggac
ttgtaccacagtcggccaggacccagcaacactgagaagatttctggactgagtcccagc
tttgtcttcctccagctctaccactctcctttctttgggaatgaggctaacaagccactg
ctgctgcctaaaactcaggtgattgaccgagctgtgaaggttctggaccagatgcctcct
tatgacacccataagatcggagtggtgtttgttggagctggtcaggttaacaatgaagtc
tccatcctttcaaacgagtacggttccaaccgctacgctgccttcctaacaggcctgggc
aaactaatccatttgaaagactgtgaccccgaccagatcttccttggagggctggaccag
tacggagacgacggagagttcacctactgctggcatgacgacatcatgcaggcgatcttc
cacatagccacactgatgccaaacagggagagcgacaagggctgctgcaacaaaaagcgt
cacattggcaacgattttgtcatggttgtgtacaatgactctggagaggactacaaactg
ggcacaattaagggccagtttaattttgtagaagtcattataaaaccactggattttgaa
tgtaacctcgtcaccctacagtgccgcaaagaccttgagggcttagttgacacaacagtg
gcaaaaatcgtttcagaccgcaaccttccactcttagtcagacagatggctctgcatgca
aacatggcctctttggtgcaccagtacagagcaaacccgtcagatgcttatgcctccaag
tggctggcgagattacgacacattaagaggatcagaaccagggcccaagaagacattcag
tctcgctcgactcccggcatctcgctgacccaaggacacactcagcagaacaagtcgttt
cagcagagcactccagcaccaaaccctgaaacctcagggcagagaaagagacttgtatca
acagtggacgatttcactgattttgtttaa

DBGET integrated database retrieval system