KEGG   Paralichthys olivaceus (Japanese flounder): 109630859
Entry
109630859         CDS       T06037                                 

Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04137  Mitophagy - animal
pov04140  Autophagy - animal
pov04210  Apoptosis
pov04621  NOD-like receptor signaling pathway
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109630859
   04137 Mitophagy - animal
    109630859
  09143 Cell growth and death
   04210 Apoptosis
    109630859
   04115 p53 signaling pathway
    109630859
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109630859
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109630859
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109630859
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109630859
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pov02000]
    109630859
Protein phosphatases and associated proteins [BR:pov01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109630859
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109630859
Transporters [BR:pov02000]
 Other transporters
  Pores ion channels [TC:1]
   109630859
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 DUF2200
Other DBs
NCBI-GeneID: 109630859
NCBI-ProteinID: XP_019944881
LinkDB
Position
Unknown
AA seq 232 aa
MSQNRELVVYYIQYKLTQTNYPLNHIGLNEPTNRTDRGETGSGEEQQTATQANGTSHGMN
TETPPDSPLRQQRLPSTTSLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSF
ENVMDEVFRDGVNWGRIIGLFAFGGALSVECVEKEMSSLVDRIIEWMTVYLDNNIQPWIQ
SQGGWEHFAEIFGNDSAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtctcaaaacagagaactggtggtttactacatacagtataaactcacccagacgaac
tatccactcaaccacattggactcaatgagcccacaaacaggactgataggggggagaca
ggctcgggtgaggaacagcagacagcgacgcaagccaacggaacttctcacggcatgaat
acagagacccctccagattccccgctgcggcagcaaaggttgccatcaacgacgagtctg
gatgcggtgaaagaggccctgcgagactcagccaacgagtttgagctgcgatacgcccgc
gccttcagcgatctgcacaaccagctgcacatcacgccggccacagcttaccaaagcttt
gagaacgtgatggacgaggtgttccgggacggcgtcaactggggccgcatcatagggctt
tttgcattcggcggggcgctgagtgtagagtgtgtggagaaggagatgagttcgctggtg
gacaggatcatagagtggatgacagtctacctagacaacaacatccagccctggatccaa
agtcaaggaggatgggagcactttgctgaaatcttcgggaacgactccgcggcggagagc
aggaggtctcaggagagcttcaagaagtggctgcttgcagggatgaccctggtgaccggg
gtcgtggtgggttcactcatagcccaaaaacgcctgtga

KEGG   Paralichthys olivaceus (Japanese flounder): 109645834
Entry
109645834         CDS       T06037                                 

Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04137  Mitophagy - animal
pov04140  Autophagy - animal
pov04210  Apoptosis
pov04621  NOD-like receptor signaling pathway
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109645834
   04137 Mitophagy - animal
    109645834
  09143 Cell growth and death
   04210 Apoptosis
    109645834
   04115 p53 signaling pathway
    109645834
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109645834
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109645834
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109645834
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109645834
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pov02000]
    109645834
Protein phosphatases and associated proteins [BR:pov01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109645834
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109645834
Transporters [BR:pov02000]
 Other transporters
  Pores ion channels [TC:1]
   109645834
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 NifU
Other DBs
NCBI-GeneID: 109645834
NCBI-ProteinID: XP_019967054
LinkDB
Position
Unknown
AA seq 195 aa
MSYSNRELVEFFISYRLSQRNYPTSLLRPEDAGGRTEGDNATSAASNGLLVNCRDRCGEQ
GRPPVTPSGGVEAVKAALLDSAEEFELLFTQAFSEVSLQLDITPDTAYHSFKNVMDEVFK
DGVNWGRIVGLFSFGGVLCVECVEKNMSELVSRIADWMTMYLDERISPWIQSQGGWVSLR
RVDPTCILMCDTDCG
NT seq 588 nt   +upstreamnt  +downstreamnt
atgtcgtacagcaacagagagctggtggagttctttatcagttacaggctgtctcagagg
aactatcccacctctctactgaggccagaggatgctggtgggaggactgagggagacaat
gccacctcggccgccagtaatggcttgctggtcaactgcagggacaggtgtggcgagcag
gggaggccacccgtcaccccgagcggtggcgtggaggccgtgaaggcagctctcctagac
tctgctgaagagtttgagctgctgttcacgcaagcgttcagtgaagtttccttgcagctc
gacatcacgcctgacacagcctaccacagcttcaagaatgtgatggatgaggtgttcaag
gacggagtcaactggggacgtatagtgggcctgttttcttttgggggtgtgctgtgtgtg
gaatgtgtggagaagaatatgagcgagctggtctcccgcattgcagactggatgaccatg
tacctggatgagcgcatcagtccgtggatccagagccaaggaggctgggtgagtctccgg
agggtggacccaacgtgcatcctcatgtgtgacacagactgtgggtga

DBGET integrated database retrieval system