KEGG   Paralichthys olivaceus (Japanese flounder): 109645723
Entry
109645723         CDS       T06037                                 

Definition
(RefSeq) serine/threonine-protein kinase Chk2-like
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109645723
   04115 p53 signaling pathway
    109645723
   04218 Cellular senescence
    109645723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109645723
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pov03400]
    109645723
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109645723
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   109645723
DNA repair and recombination proteins [BR:pov03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109645723
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo YrbL-PhoP_reg RIO1 FTA2 APH Pkinase_fungal
Other DBs
NCBI-GeneID: 109645723
NCBI-ProteinID: XP_019966912
LinkDB
Position
Unknown
AA seq 333 aa
MSDDQSTLPKELQEKYLLTRRIGMGVCGEVRLAFERSTCKKFAVKIINKHNFKSEGTATR
NAKTEINILQRIDHPCLMRTEDFYQTDDSFYIVLELMEGGELFNRIKSQQQLQESVAKLY
FYQMLRAVQYLHSNGIIHRDLKPENVLLSSQDDVCLIKVTDFNQSRILEETVLMRTLCGT
PSYLAPEVFTQASTTGYGLAVDAWSLGVLLFVCLGGYPPFHETFSQSVTDQITRGEFTMV
KSKWRRVSDQAKDVVRKLLVVDPSDRMTIEEALSHPWLQDHVMMATAYRLMYPAGDAAAM
EAESTSGRKRAREGDEDDEHPGKRIQAPPPVLL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtctgatgatcagtcgactttacctaaagaacttcaggagaaatatctgctcactcga
cgaatcggaatgggagtgtgtggtgaagtcagactggcctttgagagatcgacctgtaag
aaatttgcggtgaaaataatcaacaagcacaactttaagtctgaagggacagcgacacga
aatgcaaagacagagatcaatattctccagaggatcgaccacccgtgtctcatgaggacg
gaggacttctaccagacggacgacagcttctacatcgtgttggagctgatggagggcgga
gaactgttcaacagaatcaagtctcagcagcagcttcaagaatctgtcgccaaactttac
ttctaccagatgctgcgagcggtgcagtacctccacagtaatgggatcatccacagggac
ctgaaaccagagaacgtccttctgtcctcacaggatgacgtctgtctcattaaggtgaca
gactttaaccagtccaggatcctggaggagacagtgttgatgaggacactgtgcgggacg
ccctcgtatctcgctcctgaggtcttcactcaggcgtccaccacaggttacggtctcgct
gtggacgcctggagcctcggagtcctgctctttgtctgtctgggtggttatcctccgttc
catgagacgttcagtcagtctgtcacagatcagatcaccagaggagaatttacaatggtt
aagtccaagtggagacgagtctctgaccaagctaaagatgtggtgaggaagctgctggtt
gttgatcccagtgacaggatgacgatagaagaagctctgtctcatccctggttacaggat
catgtgatgatggcgactgcttacaggctgatgtaccctgctggagacgctgctgccatg
gaggcggagtcaacctctgggaggaaacgagcacgagaaggagacgaagacgatgaacac
cccggaaaacggatccaagccccaccccctgtcctgttgtag

DBGET integrated database retrieval system