KEGG   Paralichthys olivaceus (Japanese flounder): 109646596
Entry
109646596         CDS       T06037                                 

Gene name
rfwd2
Definition
(RefSeq) E3 ubiquitin-protein ligase RFWD2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109646596 (rfwd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109646596 (rfwd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pov04121]
    109646596 (rfwd2)
Enzymes [BR:pov01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109646596 (rfwd2)
Ubiquitin system [BR:pov04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109646596 (rfwd2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     109646596 (rfwd2)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf-RING_10 zf_C2H2_10 Prok-RING_4 DZR zf-RING_4
Other DBs
NCBI-GeneID: 109646596
NCBI-ProteinID: XP_019967916
LinkDB
Position
Unknown
AA seq 712 aa
MSSGRPQQSAGGASSVPSTSSSTTGGSGNTNGGGGSNNAVTSNGNNSGNVVPTRTLAAAG
EGGLSVPTLPAVPSSRGAFASLTRPSASSGSRKKTLHQAPLYNGLLNSYEDKSNDFVCPI
CFEMIEEAHMTKCGHSFCFKCIRQSLEDSNRCPKCNYIVDNVDQLYPNFLVNELILKQKQ
RSEEKRLKLDHPNGSRWQVFQDVLSPDQENLDLANVNLMLELLVQKKKQLEAESQAAQRQ
ILREFLKEARRNKREQLEQLQKELNFLEEDIKRVEEMSGLYSPMMEAECTVPNVEAPSPA
PSCSSIIEPPDYSQPPGFGGTTQGKRQTWYNSTLASRRKRLTAHFEDLEQCYFSNKMSRI
TDEGRNLNQLDDFMECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIA
GVTKKIKVFEYGTVIQDAVDIHYPVNEMTCNSKISCISWSSYHKNLLASSDYEGTVILWD
GFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVC
CVKFSPTSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVNGEEIVSASTD
SQLKLWNVNKTHCLRSFKGHINEKNFVGLASNGDYVACGSENNSLYLYYKGLSKTLLTFK
FDTVKSVLDKDKKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgtcaagcggccggccacagcaaagcgctggcggtgcgagctccgtgcccagcaccagc
agcagtaccacagggggcagcgggaacacgaacggtggcggcggcagcaacaacgccgtc
acaagtaatggcaacaactctgggaatgttgtgcccacccggaccctggcagcagccggg
gagggcggcttgtcggtgccaactttgcccgccgtgccttcgtcccggggcgcgtttgcc
tctctgaccagaccctctgcgtcctcgggcagcagaaagaaaaccctccatcaagcacct
ttatacaacggccttctgaattcatacgaggataaaagcaacgactttgtctgtcccatc
tgcttcgaaatgatagaggaggcgcacatgacaaagtgtgggcacagtttctgtttcaag
tgtatccgccagagcctcgaggatagcaacagatgtcccaagtgtaactatattgtggat
aatgtagatcagctttacccaaactttcttgtaaatgaactgatcctcaaacagaagcaa
aggtcagaagaaaagagactaaaattagatcatcctaatgggtctaggtggcaggtcttt
caggatgtgttgagtcctgaccaagagaacttggacttggcgaatgtcaacctgatgctg
gaactgctggttcagaagaagaagcagctagaggcggaatctcaagcagctcagagacag
atccttagggagttcctcaaagaagccagaagaaacaagagagagcaactggagcagcta
cagaaagagctcaactttcttgaagaggacataaagcgtgttgaggaaatgagtggcctg
tactctccaatgatggaggcagagtgcacggtgcctaatgtggaggctccctcaccagca
cccagctgcagtagtattattgagccaccagattacagccaacctccaggatttggtgga
acaacccagggaaaacgacagacctggtataacagcaccctggcgtcaagaagaaagagg
ctcacagctcacttcgaggatctagaacagtgctacttctccaacaaaatgtctcgcatc
acagatgagggcaggaatctgaaccagcttgatgatttcatggagtgtttgtccaagttc
actcgttacaactctgtgcggccgctggccaccctctcctacgccagtgacctttataat
ggctccagtattgtctccagtattgagtttgaccgtgactgtgactactttgccattgct
ggtgtgaccaagaagatcaaggtatttgagtacggcactgtgatccaggatgcagtcgac
atccactaccctgtcaacgaaatgacctgcaattccaaaatcagctgtatcagctggagc
agctatcacaagaaccttctggccagcagtgactatgaggggactgtcatcctgtgggat
ggattcaccggccagaggtccaaagtctatcaggaacatgaaaagaggtgttggagtgtt
gacttcaatctgatggaccccaagctcttagcctctggttctgatgatgctaaagtgaag
ctatggtcaaccaatcttgataactcagtggccagcatcgaggccaaggccaacgtctgc
tgcgttaaattcagtccaacttcccgatatcatctggcctttggctgtgcagatcactgt
gtccactactatgatctccgcaacactaagcaaccaatcatggtgttcaaaggtcatagg
aaagccgtgtcctacgccaagtttgtcaacggagaggaaattgtttctgcttcgacagac
agtcagctgaagctgtggaacgtcaacaaaacccactgtctgcgctccttcaagggtcac
atcaatgagaaaaactttgtaggcctcgcttcaaatggagactatgttgcctgcggaagc
gagaacaactccctttacctttactacaaaggactttccaagactttgttaacattcaag
tttgacacggtgaagagtgtcctggacaaggataagaaggaagacgacacaaacgagttc
gtcagtgccgtctgttggagggccctgcctgacggagaatcaaatgtgctgattgctgca
aacagtcaaggaacaatcaaggtacttgagctcgtctga

DBGET integrated database retrieval system