Panthera pardus (leopard): 109248906 Help Entry 109248906         CDS       T06062                                  Gene name IL2 Definition (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism ppad  Panthera pardus (leopard) Pathway ppad04060   Cytokine-cytokine receptor interaction ppad04061   Viral protein interaction with cytokine and cytokine receptor ppad04151   PI3K-Akt signaling pathway ppad04625   C-type lectin receptor signaling pathway ppad04630   JAK-STAT signaling pathway ppad04658   Th1 and Th2 cell differentiation ppad04659   Th17 cell differentiation ppad04660   T cell receptor signaling pathway ppad04672   Intestinal immune network for IgA production ppad04940   Type I diabetes mellitus ppad05135   Yersinia infection ppad05142   Chagas disease ppad05162   Measles ppad05166   Human T-cell leukemia virus 1 infection ppad05200   Pathways in cancer ppad05320   Autoimmune thyroid disease ppad05321   Inflammatory bowel disease ppad05330   Allograft rejection ppad05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109248906 (IL2)    04151 PI3K-Akt signaling pathway     109248906 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109248906 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     109248906 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109248906 (IL2)    04660 T cell receptor signaling pathway     109248906 (IL2)    04658 Th1 and Th2 cell differentiation     109248906 (IL2)    04659 Th17 cell differentiation     109248906 (IL2)    04672 Intestinal immune network for IgA production     109248906 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109248906 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     109248906 (IL2)    05321 Inflammatory bowel disease     109248906 (IL2)    05330 Allograft rejection     109248906 (IL2)    05332 Graft-versus-host disease     109248906 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109248906 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     109248906 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109248906 (IL2)    05162 Measles     109248906 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     109248906 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ppad04052]     109248906 (IL2)    00536 Glycosaminoglycan binding proteins [BR:ppad00536]     109248906 (IL2) Cytokines and growth factors [BR:ppad04052]  Cytokines   Interleukins    109248906 (IL2) Glycosaminoglycan binding proteins [BR:ppad00536]  Heparan sulfate / Haparin   Cytokines    109248906 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Leg1 ICAT Motif Other DBs NCBI-GeneID:  109248906 NCBI-ProteinID:  XP_019274533 Ensembl:  ENSPPRG00000008206 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML TFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS ETRFTCKYDDETATIVEFLNKWITFCQSIFSTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaattcaactcttgtcttgcattgcactgactcttatactcgtcacaaacagt gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggac ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc acatttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct gaaacaagattcacatgtaaatatgatgatgagacagcaaccattgtagaatttctgaac aaatggattaccttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system