KEGG   Panthera pardus (leopard): 109262472
Entry
109262472         CDS       T06062                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad01521  EGFR tyrosine kinase inhibitor resistance
ppad04010  MAPK signaling pathway
ppad04012  ErbB signaling pathway
ppad04014  Ras signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04915  Estrogen signaling pathway
ppad05200  Pathways in cancer
ppad05210  Colorectal cancer
ppad05211  Renal cell carcinoma
ppad05212  Pancreatic cancer
ppad05214  Glioma
ppad05215  Prostate cancer
ppad05223  Non-small cell lung cancer
ppad05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109262472 (TGFA)
   04012 ErbB signaling pathway
    109262472 (TGFA)
   04014 Ras signaling pathway
    109262472 (TGFA)
   04151 PI3K-Akt signaling pathway
    109262472 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109262472 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109262472 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109262472 (TGFA)
   05212 Pancreatic cancer
    109262472 (TGFA)
   05225 Hepatocellular carcinoma
    109262472 (TGFA)
   05214 Glioma
    109262472 (TGFA)
   05211 Renal cell carcinoma
    109262472 (TGFA)
   05215 Prostate cancer
    109262472 (TGFA)
   05223 Non-small cell lung cancer
    109262472 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109262472 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 109262472
NCBI-ProteinID: XP_019296689
LinkDB
Position
Unknown
AA seq 137 aa
MSFLSPADPPVAAAVVSHFNDCPDSHSQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHA
DLLAVVAASQKKQAITALVVVSIVALAVLIIACVLIHCCQVRKHCEWCQALICRHEKPSA
LLKGRTACCHSETAYTT
NT seq 414 nt   +upstreamnt  +downstreamnt
atgtcttttctttccccagcagacccgcctgtggccgcagctgtggtgtcccattttaat
gactgcccagattcccacagtcagttctgcttccatggaacctgcagatttttggtgcag
gaagacaagccagcatgtgtctgccattctgggtatgttggtgcacgctgtgagcatgcc
gacctcctggctgtggtggccgccagccagaagaagcaagccatcaccgccttggtggtg
gtctccatcgtggccctggctgtcctcatcatcgcatgtgtgctgatacactgctgccag
gtccggaaacactgtgagtggtgccaggccctgatctgccggcacgagaagcccagtgcc
ctgctgaagggaaggactgcttgctgccactcagagacagcttatacaacttaa

DBGET integrated database retrieval system