Pectobacterium parmentieri RNS08.42.1A: A8F97_21915 Help Entry A8F97_21915       CDS       T04513                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ppar  Pectobacterium parmentieri RNS08.42.1A Pathway ppar02024   Quorum sensing ppar03018   RNA degradation Brite KEGG Orthology (KO) [BR:ppar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     A8F97_21915  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     A8F97_21915  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ppar03019]     A8F97_21915    03036 Chromosome and associated proteins [BR:ppar03036]     A8F97_21915 Messenger RNA biogenesis [BR:ppar03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      A8F97_21915 Chromosome and associated proteins [BR:ppar03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     A8F97_21915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  AOR61512 UniProt:  A0A0H3I9H6 LinkDB All DBs Position 4816656..4816955 Genome browser AA seq 99 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNPGGSNNYHGSNTTAQQQSQDADDAE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcttgaacgctttgcgtcgtgaacgtgtt ccggtttcgatttatttggtgaacggtattaagctgcaaggtcagatcgaatctttcgat caattcgtgattttgttgaaaaacacggtcagtcagatggtttataaacatgccatctct acagttgttccttctcgcccagtttctcaccatagcaacaatcctggcggcagcaacaac tatcatggtagtaacacgactgctcagcaacagtcgcaggatgctgatgacgccgaataa

DBGET integrated database retrieval system