KEGG   Prunus persica (peach): 18772664Help
Entry
18772664          CDS       T03092                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pper  Prunus persica (peach)
Pathway
pper03030  DNA replication
pper03410  Base excision repair
pper03420  Nucleotide excision repair
pper03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pper00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18772664
   03410 Base excision repair
    18772664
   03420 Nucleotide excision repair
    18772664
   03430 Mismatch repair
    18772664
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pper03032]
    18772664
   03400 DNA repair and recombination proteins [BR:pper03400]
    18772664
Enzymes [BR:pper01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     18772664
    6.5.1.6  DNA ligase (ATP or NAD+)
     18772664
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     18772664
DNA replication proteins [BR:pper03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    18772664
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     18772664
DNA repair and recombination proteins [BR:pper03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     18772664
   NER (nucleotide excision repair)
    Other NER factors
     18772664
   MMR (mismatch excision repair)
    Other MMR factors
     18772664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 18772664
NCBI-ProteinID: XP_007207143
UniProt: M5W3M2
LinkDB All DBs
Position
G6
AA seq 789 aa AA seqDB search
MLSRSLCSCYCLRPHSVHHLSTSISLFRSKPSSLSLTLISLSPKNPNLRAMSSRPSAFDA
LMSGARAAAAKKKPQASPSKKRKTLEPNPIENPQLLLKPENGSPTQAPESKEVKEALESS
SNGGQVVPLAKKVCAAAGAQERMAELKSRIALLKKKAGDFDPKLMANWGEGERVPFAFVC
LAFDLIANETGRIVITDIVCNLLRTVMHTTPEDLVPVVYLAANRIAPAHEGLELGIGDAS
IIKALAEACGRTEAHVKKQYKELGDLGLVAKASRSSQSMMRKPDSLTVTKVFSTFRQLAK
ESGKDSQEKKKNHIKALLVAATDCEPQYLIRLLQTKLRIGLAEQTLLAALGQAAVHAEKH
STPPSHIQSPIEEAAKIVKQVYSLLPDYDKIIPALLSGGVWNLPKTCSFTLGVPVGPMLA
KPTKGVSEIVQKFQDTEYTCEYKYDGERAQIHYMDDGSVEIYSRNAERNTGKFPDVVVAV
SRLKKSSVTSFVLDCELVAYDRVKQKILPFQVLSTRARKNVAMSDIKVDVCIFAFDMLYL
NGQPLIQEQLKVRRESLYDSFVEEAGFFQFATAITSNDIEEIQKFLDAAVDSSSEGLIIK
TLNKDATYEPSKRSLNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDS
NNEEFQSICKIGTGFSEAMLEERSASLRTKVIPKPKSYYRYAETMNPDVWFDASEVWEVK
AADLTISPVHRAAVGIVDPNKGISLRFPRLVRVREDKPPEQASSSAQVAEMYSAQANTRS
NNQDDNEDD
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgatcactgtgttcatgctattgcctacgcccacactctgtccaccatctc
agcacctccatttctctcttccgctccaaaccctcttctctctctctcaccctcatttcc
ctctccccgaaaaaccctaatcttcgcgccatgtcctctcgcccctccgccttcgacgct
ctcatgtccggcgctcgcgccgccgccgccaagaaaaagccccaagcttcaccctccaag
aagcgaaaaaccctagaacctaaccctattgaaaacccccaattgctattgaaacccgaa
aatggcagtccaacccaagccccagaatccaaggaagtcaaagaagctctagaaagttct
agtaatggcggccaggtggttcccctcgcgaaaaaagtgtgcgcggcggcaggtgctcag
gagcggatggcggaattgaagagccgaatcgctctgttgaagaagaaagccggtgacttt
gacccgaaattgatggcgaattggggcgagggcgagagggttccgtttgcgtttgtttgt
ttggcttttgatttgattgctaacgagacgggtcggattgtgatcacggatatagtgtgt
aacctgttgaggactgtaatgcacaccacgcctgaggatttggtgcccgtggtttatctg
gcagcaaatcggattgcgccggcgcatgagggattggagcttggaattggggatgcttcg
attatcaaggcgcttgcagaggcttgtgggaggactgaagcacatgttaagaaacaatac
aaggaattgggagatttgggtcttgttgcaaaagcaagccgttcatctcaatctatgatg
cgcaagcctgattcgttaactgtcaccaaggttttcagtacatttcgtcaacttgctaag
gaatctgggaaggatagtcaggagaagaaaaagaaccatatcaaggcacttcttgttgct
gccactgattgtgaacctcaatatctgatccgtttacttcagacaaagttgcgaattggg
ttggcagagcagactctcttagctgcattgggacaagctgcagtgcatgctgaaaaacat
tctacaccaccttctcatattcagagtcctatagaagaggctgcaaagattgttaagcaa
gtgtactctctacttcctgattacgataaaatcatccctgcccttttaagtggtggtgtg
tggaatcttccgaagacatgtagctttactttgggtgtcccagtgggacctatgctagca
aagccaactaaaggtgtatctgagattgtacagaagtttcaggatacagaatacacctgt
gaatacaagtatgatggagaacgtgcccagatacattacatggatgatggttctgttgag
atatacagtcgaaatgctgaacgaaacactggaaagttccctgatgttgttgttgcagtg
tcgaggttaaagaagtcatctgtaacgtcatttgttttggattgtgaattggttgcttat
gaccgtgtaaaacagaaaattcttcctttccaggtactcagcactagagctcgtaaaaat
gtggccatgagtgatattaaggtcgatgtctgcatatttgcttttgacatgttgtatctt
aatggacaaccactaattcaggaacaactgaaagttcgtagagagagtctttatgactct
tttgtggaagaagctggattttttcagtttgccacagcaataacatcaaatgatattgaa
gaaatacaaaagtttcttgatgctgcagttgattcaagttctgagggtttaattatcaaa
acattgaacaaagatgctacttacgagccttcaaagcggtcacttaactggctgaaattg
aagaaagattatatggagagtattggggactcactagacttggtacctattgctgctttc
catggccgggggaaacgtacaggtgtctatggtgctttcctccttgcttgttatgatagc
aacaatgaagagtttcaaagcatttgtaaaataggcactggattctctgaagcaatgctt
gaagaacgttctgccagtctccgtactaaagtgatacccaaacctaagtcatactatcgt
tatgcagagacgatgaatcctgatgtatggtttgatgcctctgaggtttgggaagtgaaa
gctgcggacttgactattagccctgttcatcgcgccgcagttggcatagtggatcctaat
aagggtatttctcttcgatttccacgtcttgttcgtgttcgggaagataaacctccagag
caagcctcatcatctgcgcaggttgctgagatgtattctgctcaagctaacactcgttcg
aacaatcaagatgacaacgaagatgattaa

DBGET integrated database retrieval system