Pseudomonas putida F1: Pput_0341 Help Entry Pput_0341         CDS       T00537                                  Name (GenBank) cell division protein ZapA   KO K09888   cell division protein ZapA Organism ppf  Pseudomonas putida F1 Brite KEGG Orthology (KO) [BR:ppf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppf03036]     Pput_0341 Chromosome and associated proteins [BR:ppf03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Pput_0341 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapA Motif Other DBs NCBI-ProteinID:  ABQ76514 UniProt:  A5VXA4 LinkDB All DBs Position 388617..388919 Genome browser AA seq 100 aa AA seqDB search MRLQEQPINVVSILGIDYSIKAPEGQEETLAQAVRMLNKALNETKRQYPTLIGDKLLVLA ALNLCSKQVELQKEHQQTLARTQAQIDATVDAIVRTIAEQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgagactgcaagagcagccgatcaatgtcgtgtcgattctcggcatcgactattcgatc aaggcgcccgaaggccaggaagaaaccctggcccaggcggtacggatgctcaacaaagcc cttaacgagaccaagcgtcagtacccgaccttgatcggtgacaaactgctggtgctggct gcccttaacctgtgctccaaacaggttgaactgcagaaagagcatcagcagacccttgcg cgaactcaagcgcagatcgacgccacggtggatgccatcgtgcggaccattgcagagcaa taa

DBGET integrated database retrieval system