KEGG   Pseudomonas putida ND6: ND059
Entry
ND059             CDS       T02170                                 

Gene name
nahC
Definition
(GenBank) 1,2-dihydroxy-naphthalene dioxygenase
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00626  Naphthalene degradation
ppi01100  Metabolic pathways
ppi01120  Microbial metabolism in diverse environments
ppi01220  Degradation of aromatic compounds
Module
ppi_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    ND059 (nahC)
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.56  1,2-dihydroxynaphthalene dioxygenase
     ND059 (nahC)
SSDB
Motif
Pfam: Glyoxalase YdiH
Other DBs
NCBI-ProteinID: AAP44292
UniProt: Q6XUJ3
LinkDB
Position
pND6-1:60179..61087
AA seq 302 aa
MSKQAAVIELGYMGISVKDPDAWKSFATDMLGLQVLDEGEKDRFYLRMDYWHHRIVVHHN
GQDDLEYLGWRVAGKPEFEALGQKLIDAGYKIRICDKVEAQERMVLGLMKTEDPGGNPTE
IFWGPRIDMSNPFHPGRPLHGKFVTGDQGLGHCIVRQTDVAEAHKFYSLLGFRGDVEYRI
PLPNGMTAELSFMHCNARDHSIAFGAMPAAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDI
ALQLGIHANDKALTFYGATPSGWLIEPGWRGATAIDEAEYYVGDIFGHGVEATGYGLDVK
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagtaagcaagctgcagttatcgagctcggatacatgggtatctcggtcaaggaccct
gatgcgtggaaatcatttgccacggatatgctaggtctgcaagttcttgatgagggtgag
aaggaccgtttctatctgcggatggattactggcatcatcggatcgtagtccatcacaac
ggacaggacgacttggagtacctaggctggcgtgtagccggcaagccggagttcgaagct
ctgggtcaaaagcttattgatgccggttacaagatccgcatctgcgacaaagttgaggct
caggagcgtatggtgttgggtctgatgaagacagaagatccgggcggcaacccgaccgag
atattctggggcccccggatcgacatgagcaacccgttccatcccggtcgccccctgcac
ggaaagtttgtgaccggtgaccaaggcttgggccattgcatcgttcgccaaaccgacgtc
gcagaagctcataagttttatagcctgctgggcttccgtggggacgtcgaataccggatt
ccgttgcccaacggcatgactgccgaactgtcgttcatgcattgcaacgcccgtgatcac
tccattgcttttggtgccatgcccgctgccaaacgactcaatcacttgatgcttgagtac
acccatatggaagacttgggatacacgcaccaacagtttgtaaagaacgaaattgacatt
gccttgcagcttggcattcacgccaacgacaaggcgttgacgttctatggtgcaacgcct
tcgggctggctcattgagcccggctggcgaggtgccacggccatagatgaagcggagtat
tacgtcggcgacatcttcggccatggcgtggaggccactggatatggcctggatgtaaaa
ctgagctaa

DBGET integrated database retrieval system