Pyramidobacter piscolens: CE91St28_02030 Help Entry CE91St28_02030    CDS       T08073                                  Name (GenBank) pyruvate synthase subunit PorD   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism ppio  Pyramidobacter piscolens Pathway ppio00010   Glycolysis / Gluconeogenesis ppio00020   Citrate cycle (TCA cycle) ppio00620   Pyruvate metabolism ppio00640   Propanoate metabolism ppio00650   Butanoate metabolism ppio00680   Methane metabolism ppio01100   Metabolic pathways ppio01110   Biosynthesis of secondary metabolites ppio01120   Microbial metabolism in diverse environments ppio01200   Carbon metabolism ppio01210   2-Oxocarboxylic acid metabolism Module ppio_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:ppio00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     CE91St28_02030    00020 Citrate cycle (TCA cycle)     CE91St28_02030    00620 Pyruvate metabolism     CE91St28_02030    00640 Propanoate metabolism     CE91St28_02030    00650 Butanoate metabolism     CE91St28_02030   09102 Energy metabolism    00680 Methane metabolism     CE91St28_02030   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     CE91St28_02030 Enzymes [BR:ppio01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      CE91St28_02030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_6 Fer4_9 Fer4_21 Fer4_16 Fer4_4 Fer4_3 Fer4_17 Fer4_8 Fer4_5 Motif Other DBs NCBI-ProteinID:  BDF77409 LinkDB All DBs Position complement(214189..214494) Genome browser AA seq 101 aa AA seqDB search MSHFAKDMTPSITWKEITPGCNIYEGGTSVSVETGDWRTERPVIDFAKCKQCLLCVPVCP DMSIPITDGKRGDFNYFFCKGCGVCSNVCPFGAITMVPEQK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagccactttgcaaaagatatgacacccagcatcacctggaaagagatcacgcccggc tgcaacatttatgaaggcggcacttccgtttctgtcgagaccggcgactggcgcaccgaa cgcccggtgatcgactttgccaaatgcaagcagtgcctgctgtgcgtccccgtctgtccc gatatgtccatcccgatcacggacggcaagcgcggcgatttcaactactttttctgcaag ggctgcggcgtctgttccaacgtttgcccctttggcgcgatcaccatggttcctgaacaa aagtaa

DBGET integrated database retrieval system