KEGG   Pandoraea pnomenusa DSM 16536: LV28_20040Help
Entry
LV28_20040        CDS       T03411                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LV28_20040
Enzymes [BR:ppnm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LV28_20040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 DAO FAD_binding_2 Glutaredoxin FAD_oxidored HI0933_like Thi4 K_oxygenase FAD_binding_3 NAD_binding_8 FMO-like AlaDh_PNT_C NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AIU28543
UniProt: A0A378YWL0
LinkDB All DBs
Position
complement(4210099..4211691)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKSAEMKALVDEIAPLSAQIRVAARDDAQE
RRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPVKLDDDTIAQIRALDGDFR
FETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQGEVEARQVMAVPTVFLNGES
FTQGRTSVKELLAKLDTGATARAAKALENKPVYDMLIVGGGPAGAAAAIYAARKGIATGV
VAERFGGQVLDTMAIENFVSVTHTEGPKFAVALEQHVKTYDVDVIDTQRAEALIPGKIHE
VHLASGAVLKARAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVSEVTLIEYGAQLRADEVLQRKLRSLPNVRVLTNAQTTEIVGDTQKV
NALVYRDRVSGETSTIALEGVFVQIGLVPNTEWLKGTVALSRHGEIEVDAKGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFEHLMLSSVEDDAAQAPREAVAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccaattgcaaacgtaccttcagaaagtcacgcggccg
atcgagatcgccgtgtggctcgacgacagcccgaaatcggccgagatgaaggcgctggtc
gacgagatcgcaccgctcagcgcgcagatccgcgtggcggcgcgcgacgacgcgcaggag
cgtcgtccgtcgttcgccatcggcacgccgggcgaggcgccgcgtattcgcttcgccgga
ctgccgatggggcacgaattcacctcgctcgtgctggcgctgctgcaagtcggcggccac
ccggtgaagctcgacgatgacaccatcgcccagattcgcgcgctcgacggcgacttccgc
ttcgagacatatatctcgctgtcttgccagaactgcccggaagtcgtgcaggcgctcaat
gtcatggcgctcatcaatccgcgcatccagcaggtaacgatcgacggcgcgttgttccag
ggggaagtcgaggcgcgccaggtaatggccgtgccgacggtgtttctcaacggcgagtcg
ttcacgcagggccgcaccagcgtgaaggaattgctcgcgaagctcgacaccggcgcgacg
gcccgcgccgcgaaggcgcttgaaaacaagccggtctatgacatgctgatcgtcggcggt
ggcccggcaggcgcggccgctgcgatctacgcggcccgcaagggcatcgcgacgggcgtg
gtggcggagcgattcggcggtcaggtgctcgacaccatggccatcgagaacttcgtctcg
gtgacgcataccgaaggcccgaagttcgccgtggcgctcgagcagcacgtcaagacgtac
gacgtcgacgtcatcgacacgcaacgcgccgaagcgctgatcccggggaagatccacgag
gtgcacctggccagcggcgcggtgctcaaggcgcgcgcggtggtgctggccaccggcgcg
cgctggcgggaaatcggcgtgccgggcgagcgcgaataccgcaatcgcggtgtggcgtac
tgcccgcattgcgacggtccgctcttcaagggcaagcgcgttgcggtcgtgggtggcggc
aattcgggtgtggaggcggccatcgatctcgcgggcatcgtcagcgaggtcacgctgatc
gagtacggcgcgcaactgcgtgcggacgaagtgctccagcgcaagctgcgcagtctgccc
aacgtgcgcgtgctcacgaacgcgcagacgaccgaaatcgtcggcgacacgcaaaaggtc
aacgcgctcgtgtaccgcgatcgcgtctcgggtgagacgtcgacgattgcgctcgaaggc
gtgttcgtgcagatcggcctggtaccgaacaccgagtggctcaagggcaccgtggcgctg
tcgcgccatggcgaaatcgaggtcgatgcgaagggggcgacgtcggtgcccggcgtgttc
gcggcgggcgacgtgacgaccgtacctttcaagcagatcgtcatcgccgtgggcgagggc
gccaaggcatcgctcggcgccttcgaacacctgatgctcagctcggtggaggacgacgcc
gcacaggcgccgcgcgaggccgtcgccgcctga

DBGET integrated database retrieval system