KEGG   Pan paniscus (bonobo): 100967294
Entry
100967294         CDS       T02283                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04630  JAK-STAT signaling pathway
pps04640  Hematopoietic cell lineage
pps04664  Fc epsilon RI signaling pathway
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05221  Acute myeloid leukemia
pps05310  Asthma
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100967294 (IL3)
   04151 PI3K-Akt signaling pathway
    100967294 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100967294 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100967294 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100967294 (IL3)
   04664 Fc epsilon RI signaling pathway
    100967294 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100967294 (IL3)
   05202 Transcriptional misregulation in cancer
    100967294 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100967294 (IL3)
  09163 Immune disease
   05310 Asthma
    100967294 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100967294 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100967294 (IL3)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100967294 (IL3)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Haparin
  Cytokines
   100967294 (IL3)
SSDB
Motif
Pfam: IL3 Ldl_recept_b
Other DBs
NCBI-GeneID: 100967294
NCBI-ProteinID: XP_003829364
UniProt: A0A2R9B411
LinkDB
Position
5
AA seq 154 aa
MSRLPVLILLLLQLLVRPGLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNN
LNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIRI
KDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
NT seq 465 nt   +upstreamnt  +downstreamnt
atgagccgcctgcccgtcctgatcctgctcctgctccaactcctggtccgccccggactc
caagctcccatgacccagacaacgtccttgaagacaagctgggttaactgctctaacatg
atcgatgaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaac
ctcaatggggaagaccaagacattctgatggaaaataaccttcgaaggccaaacctggag
gcattcaacagggctgtcaagagtttacagaacgcatcagcaattgagagcattcttaaa
aatctcctgccatgtctgcccctggccacggccgcacccacgcgacatccaatccgtatc
aaggacggtgactggaatgaattccggaggaaactgacattctatctgaaaacccttgag
aatgcgcaggctcaacagacgactttgagcctcgcgatcttttga

DBGET integrated database retrieval system