Pan paniscus (bonobo): 100967294 Help Entry 100967294         CDS       T02283                                  Symbol IL3 Name (RefSeq) interleukin-3   KO K04736   interleukin 3 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04151   PI3K-Akt signaling pathway pps04210   Apoptosis pps04630   JAK-STAT signaling pathway pps04640   Hematopoietic cell lineage pps04664   Fc epsilon RI signaling pathway pps05200   Pathways in cancer pps05202   Transcriptional misregulation in cancer pps05221   Acute myeloid leukemia pps05310   Asthma Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100967294 (IL3)    04151 PI3K-Akt signaling pathway     100967294 (IL3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100967294 (IL3)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100967294 (IL3)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100967294 (IL3)    04664 Fc epsilon RI signaling pathway     100967294 (IL3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100967294 (IL3)    05202 Transcriptional misregulation in cancer     100967294 (IL3)   09162 Cancer: specific types    05221 Acute myeloid leukemia     100967294 (IL3)   09163 Immune disease    05310 Asthma     100967294 (IL3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100967294 (IL3)    00536 Glycosaminoglycan binding proteins [BR:pps00536]     100967294 (IL3) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Interleukins    100967294 (IL3) Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Heparin   Cytokines    100967294 (IL3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL3 Ldl_recept_b CdiA_C_tRNase Motif Other DBs NCBI-GeneID:  100967294 NCBI-ProteinID:  XP_003829364 Ensembl:  ENSPPAG00000034624 UniProt:  A0A2R9B411 LinkDB All DBs Position 4:127379116..127381660 Genome browser AA seq 152 aa AA seqDB search MSRLPVLLLLQLLVRPGLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIRIKD GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgagccgcctgcccgtcctgctcctgctccaactcctggtccgccccggactccaagct cccatgacccagacaacgtccttgaagacaagctgggttaactgctctaacatgatcgat gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat ggggaagaccaagacattctgatggaaaataaccttcgaaggccaaacctggaggcattc aacagggctgtcaagagtttacagaacgcatcagcaattgagagcattcttaaaaatctc ctgccatgtctgcccctggccacggccgcacccacgcgacatccaatccgtatcaaggac ggtgactggaatgaattccggaggaaactgacattctatctgaaaacccttgagaatgcg caggctcaacagacgactttgagcctcgcgatcttttga

DBGET integrated database retrieval system