KEGG   Pan paniscus (bonobo): 100972902
Entry
100972902         CDS       T02283                                 

Gene name
RAF1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04218  Cellular senescence
pps04270  Vascular smooth muscle contraction
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04720  Long-term potentiation
pps04722  Neurotrophin signaling pathway
pps04726  Serotonergic synapse
pps04730  Long-term depression
pps04810  Regulation of actin cytoskeleton
pps04910  Insulin signaling pathway
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04926  Relaxin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04935  Growth hormone synthesis, secretion and action
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05034  Alcoholism
pps05132  Salmonella infection
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100972902 (RAF1)
   04012 ErbB signaling pathway
    100972902 (RAF1)
   04014 Ras signaling pathway
    100972902 (RAF1)
   04015 Rap1 signaling pathway
    100972902 (RAF1)
   04370 VEGF signaling pathway
    100972902 (RAF1)
   04371 Apelin signaling pathway
    100972902 (RAF1)
   04630 JAK-STAT signaling pathway
    100972902 (RAF1)
   04068 FoxO signaling pathway
    100972902 (RAF1)
   04072 Phospholipase D signaling pathway
    100972902 (RAF1)
   04071 Sphingolipid signaling pathway
    100972902 (RAF1)
   04024 cAMP signaling pathway
    100972902 (RAF1)
   04022 cGMP-PKG signaling pathway
    100972902 (RAF1)
   04151 PI3K-Akt signaling pathway
    100972902 (RAF1)
   04150 mTOR signaling pathway
    100972902 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100972902 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    100972902 (RAF1)
   04218 Cellular senescence
    100972902 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100972902 (RAF1)
   04540 Gap junction
    100972902 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100972902 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100972902 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100972902 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    100972902 (RAF1)
   04660 T cell receptor signaling pathway
    100972902 (RAF1)
   04662 B cell receptor signaling pathway
    100972902 (RAF1)
   04664 Fc epsilon RI signaling pathway
    100972902 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    100972902 (RAF1)
   04062 Chemokine signaling pathway
    100972902 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100972902 (RAF1)
   04929 GnRH secretion
    100972902 (RAF1)
   04912 GnRH signaling pathway
    100972902 (RAF1)
   04915 Estrogen signaling pathway
    100972902 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    100972902 (RAF1)
   04917 Prolactin signaling pathway
    100972902 (RAF1)
   04921 Oxytocin signaling pathway
    100972902 (RAF1)
   04926 Relaxin signaling pathway
    100972902 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    100972902 (RAF1)
   04919 Thyroid hormone signaling pathway
    100972902 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    100972902 (RAF1)
   04916 Melanogenesis
    100972902 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100972902 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    100972902 (RAF1)
   04720 Long-term potentiation
    100972902 (RAF1)
   04730 Long-term depression
    100972902 (RAF1)
   04722 Neurotrophin signaling pathway
    100972902 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    100972902 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972902 (RAF1)
   05206 MicroRNAs in cancer
    100972902 (RAF1)
   05205 Proteoglycans in cancer
    100972902 (RAF1)
   05230 Central carbon metabolism in cancer
    100972902 (RAF1)
   05231 Choline metabolism in cancer
    100972902 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100972902 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100972902 (RAF1)
   05212 Pancreatic cancer
    100972902 (RAF1)
   05225 Hepatocellular carcinoma
    100972902 (RAF1)
   05226 Gastric cancer
    100972902 (RAF1)
   05214 Glioma
    100972902 (RAF1)
   05221 Acute myeloid leukemia
    100972902 (RAF1)
   05220 Chronic myeloid leukemia
    100972902 (RAF1)
   05218 Melanoma
    100972902 (RAF1)
   05211 Renal cell carcinoma
    100972902 (RAF1)
   05219 Bladder cancer
    100972902 (RAF1)
   05215 Prostate cancer
    100972902 (RAF1)
   05213 Endometrial cancer
    100972902 (RAF1)
   05224 Breast cancer
    100972902 (RAF1)
   05223 Non-small cell lung cancer
    100972902 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100972902 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100972902 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    100972902 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100972902 (RAF1)
   05152 Tuberculosis
    100972902 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100972902 (RAF1)
   05161 Hepatitis B
    100972902 (RAF1)
   05160 Hepatitis C
    100972902 (RAF1)
   05164 Influenza A
    100972902 (RAF1)
   05163 Human cytomegalovirus infection
    100972902 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100972902 (RAF1)
   05165 Human papillomavirus infection
    100972902 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100972902 (RAF1)
   01522 Endocrine resistance
    100972902 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100972902 (RAF1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100972902 (RAF1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100972902 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 100972902
NCBI-ProteinID: XP_008949956
UniProt: A0A2R9B7H5
LinkDB
Position
3
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVNPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagacgatcagcaatggttttggattcaaagatgcc
gtgtttgatggctccagctgcatctctcctacaatagttcagcagtttggctatcagcgc
cgggcatcagatgatggcaaactcacagatccttctaagacaagcaacactatccgtgtt
ttcttgccgaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaaaggtaaaaaagcacgcttagattggaatactgatgctgcgtct
ttgattggagaagaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagacgttcctgaagcttgccttctgtgacatctgtcagaaattcctgctc
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaacatcagacagctcttattgtttccaaattccact
attggtgatagtggagtcccagcactaccttctttgactatgcgtcgtatgcgagagtct
gtttccaggatgcctgttagttctcagcacagatattctacacctcacgccttcaccttt
aacacctccagtccctcatctgaaggttccctctcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagtcacagcgaatcagcctcaccttcagccctgtccagtagccccaacaatctg
agcccaacaggctggtcacagccgaaaacccccgtgccagcacaaagagagcgggcacca
gtatctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tattgggaaatagaagccagtgaagtgatgctgtccactcggattgggtcaggctctttt
ggaactgtttataagggtaaatggcacggagatgttgcagtaaagatcctaaaggttgtc
aacccaaccccagagcaattccaggccttcaggaatgaggtggctgttctgcgcaaaaca
cggcatgtgaacattctgcttttcatggggtacatgacaaaggacaacctggcaattgtg
acccagtggtgcgagggcagcagcctctacaaacacctgcatgtccaggagaccaagttt
cagatgttccagctaattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccatagagacatgaaatccaacaatatatttctccatgaaggctta
acagtgaaaattggagattttggtttggcaacagtaaagtcacgctggagtggttctcag
caggttgaacaacctactggctctgtcctctggatggccccagaggtgatccgaatgcag
gataacaacccattcagtttccagtcggatgtctactcctatggcatcgtattgtatgaa
ctgatgacgggggagcttccttattctcacatcaacaaccgagatcagatcatcttcatg
gtgggccgaggatatgcctccccagatcttagtaagctatataagaactgccccaaagca
atgaagaggctggtagctgactgtgtgaagaaagtaaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccaacactctctaccgaagatcaaccggagcgct
tccgagccatccttgcatcgggcagcccacactgaggatatcaatgcttgcacgctgacc
acgtccccgaggctgcctgtcttctag

DBGET integrated database retrieval system