KEGG   Pan paniscus (bonobo): 100973153
Entry
100973153         CDS       T02283                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04915  Estrogen signaling pathway
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05223  Non-small cell lung cancer
pps05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100973153 (TGFA)
   04012 ErbB signaling pathway
    100973153 (TGFA)
   04014 Ras signaling pathway
    100973153 (TGFA)
   04151 PI3K-Akt signaling pathway
    100973153 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100973153 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100973153 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100973153 (TGFA)
   05212 Pancreatic cancer
    100973153 (TGFA)
   05225 Hepatocellular carcinoma
    100973153 (TGFA)
   05214 Glioma
    100973153 (TGFA)
   05211 Renal cell carcinoma
    100973153 (TGFA)
   05215 Prostate cancer
    100973153 (TGFA)
   05223 Non-small cell lung cancer
    100973153 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100973153 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154 Lysis_col
Other DBs
NCBI-GeneID: 100973153
NCBI-ProteinID: XP_003830995
UniProt: A0A2R9CIG2
LinkDB
Position
2A
AA seq 166 aa
MFRIGRGALDLLSELLSFGGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQF
CFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVL
IITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 501 nt   +upstreamnt  +downstreamnt
atgttcaggatcggcagaggcgccctcgatctcctttcagagctcttgagctttgggggt
attgtgttggctgcgtgccaggccttggagaacagcacgtccccgctgagtgcagacccg
cccgtggctgcagcagtggtgtcccattttaatgactgcccagattcccacactcagttc
tgcttccatggaacctgcaggtttttggtgcaggaggacaagccagcatgtgtctgccat
tctgggtacgttggtgcacgctgtgagcatgcagacctcctggccgtggtggctgccagc
cagaagaagcaggccatcaccgccttggtggtggtctccatcgtggccctggctgtcctt
atcattacatgtgtgctgatacactgctgccaggtccgaaaacattgtgagtggtgccgg
gccctcatctgccggcacgagaagcccagtgccctcctgaagggaagaaccgcttgctgc
cactcagaaacagtggtctga

DBGET integrated database retrieval system