Pan paniscus (bonobo): 100979809 Help Entry 100979809         CDS       T02283                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X2   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pps  Pan paniscus (bonobo) Pathway pps01521   EGFR tyrosine kinase inhibitor resistance pps01524   Platinum drug resistance pps04014   Ras signaling pathway pps04064   NF-kappa B signaling pathway pps04115   p53 signaling pathway pps04137   Mitophagy - animal pps04140   Autophagy - animal pps04151   PI3K-Akt signaling pathway pps04210   Apoptosis pps04215   Apoptosis - multiple species pps04621   NOD-like receptor signaling pathway pps04630   JAK-STAT signaling pathway pps05012   Parkinson disease pps05014   Amyotrophic lateral sclerosis pps05022   Pathways of neurodegeneration - multiple diseases pps05145   Toxoplasmosis pps05162   Measles pps05166   Human T-cell leukemia virus 1 infection pps05168   Herpes simplex virus 1 infection pps05170   Human immunodeficiency virus 1 infection pps05200   Pathways in cancer pps05202   Transcriptional misregulation in cancer pps05212   Pancreatic cancer pps05220   Chronic myeloid leukemia pps05222   Small cell lung cancer pps05225   Hepatocellular carcinoma pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100979809 (BCL2L1)    04630 JAK-STAT signaling pathway     100979809 (BCL2L1)    04064 NF-kappa B signaling pathway     100979809 (BCL2L1)    04151 PI3K-Akt signaling pathway     100979809 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100979809 (BCL2L1)    04137 Mitophagy - animal     100979809 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     100979809 (BCL2L1)    04215 Apoptosis - multiple species     100979809 (BCL2L1)    04115 p53 signaling pathway     100979809 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100979809 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100979809 (BCL2L1)    05202 Transcriptional misregulation in cancer     100979809 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     100979809 (BCL2L1)    05225 Hepatocellular carcinoma     100979809 (BCL2L1)    05220 Chronic myeloid leukemia     100979809 (BCL2L1)    05222 Small cell lung cancer     100979809 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100979809 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     100979809 (BCL2L1)    05162 Measles     100979809 (BCL2L1)    05168 Herpes simplex virus 1 infection     100979809 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100979809 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     100979809 (BCL2L1)    05014 Amyotrophic lateral sclerosis     100979809 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     100979809 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100979809 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100979809 (BCL2L1)    01524 Platinum drug resistance     100979809 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pps01009]     100979809 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pps03036]     100979809 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pps02000]     100979809 (BCL2L1) Protein phosphatases and associated proteins [BR:pps01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100979809 (BCL2L1) Chromosome and associated proteins [BR:pps03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100979809 (BCL2L1) Transporters [BR:pps02000]  Other transporters   Pores ion channels [TC:1]    100979809 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100979809 NCBI-ProteinID:  XP_003814810 Ensembl:  ENSPPAG00000000042 UniProt:  A0A2R8Z9D7 LinkDB All DBs Position 21:complement(37358784..37419063) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctatgggaacaatgcagca gccgagagccgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system