KEGG   Pan paniscus (bonobo): 100981147
Entry
100981147         CDS       T02283                                 

Gene name
NLRP4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100981147 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pps04054]
    100981147 (NLRP4)
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100981147 (NLRP4)
Pattern recognition receptors [BR:pps04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100981147 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 VirE AAA_14 AAA_22 ResIII DAP3 AAA_25 AAA_30
Other DBs
NCBI-GeneID: 100981147
NCBI-ProteinID: XP_008960417
UniProt: A0A2R9AX44
LinkDB
Position
19
AA seq 994 aa
MAASFFSEFGLMWYLEELKKEEFRKFKEHLKQMTLHLELKQIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIH
LYFEEEVKQEECDHLDRLFAPKETGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRD
RFLYTFYFCCRELRELPPTSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELQGSL
NEPDSDLCGDLMEERPVQVLLSSLLRKKMLPEASLLIAVKPVCPKELRDQVTISEIYQPR
GFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LALTCQSTTSVYSSFVFNLFTPEGAEGPTPQSQHQLKALCSLAAEGMWTDTFEFCEDDLR
RNGVVDADIPALLGTKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCV
QELLVANFEKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQFHQCLKSLGE
HGNPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEANFHIIDNVDLVVSAYCLKYCSSLR
KLCFSVQNVFKKEDEHSSTSDYSLVCWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCN
QLRHPSCRLQKLGINNVSFSGQSVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNY
PAGNVKELGLVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTV
LVYLMLAFCHLSEQCCQYISEMLLHNKSVRYLDLSANVLKDEGLRTLCEALKHPDCCLDS
LCLVKCFITAAGCEDLASALISNQNLKILQVGCNEIGDVGVQLLCRALTHPDCRLEILGL
EECGLTSTCCKDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEALRHPECALQVLGLRKT
DFDEETQALLTAEEERNPNLTITDDCDTITRVEI
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggcagcctctttcttctctgagtttggtcttatgtggtatctggaggagctcaaaaag
gaggagttcaggaaatttaaagaacatctcaagcaaatgactttgcatcttgaactcaag
cagattccctggactgaggtcaaaaaagcatcccgggaagaacttgcaaacctcttgatc
aagcactatgaagaacaacaagcttggaacataaccttaagaatctttcaaaagatggat
agaaaggatctctgcatgaaggtcatgagggagagaacaggatacacaaagacctatcaa
gctcacgcaaagcagaaattcagccgcttatggtccagcaagtctgtcactgagattcac
ctatactttgaggaggaagtcaagcaagaagaatgtgaccatttggaccgcctttttgct
cccaaggaaactgggaaacagccacgtacagtgatcattcaaggaccacaaggaattgga
aaaacgacactcctgatgaagctgatgatggcctggtcggacaacaagatctttcgggat
aggttcctgtacacattctatttctgctgcagagaactgagggagttgccgccaacgagt
ttggctgacttgatttccagagagtggcctgaccccgctgctcctataacagagatcgtg
tctcaaccggagagactcttgttcgtcatcgacagcttcgaagagctgcagggcagcttg
aatgaacccgattcggatctgtgtggtgacttgatggaggaacggccggtgcaggtgctt
ctgagcagtttgctgaggaagaagatgctcccggaggcctccctgctcatcgccgtcaaa
cccgtgtgcccgaaggagctccgggatcaggtgacgatctcagaaatctaccagccccgg
ggattcaacgagagtgataggttagtgtatttctgctgtttcttcaaagacccgaaaaga
gccatggaagccttcaatcttgtaagagaaagtgaacagctgttttccatatgccaaatc
ccgctcctctgctggatcctgtgtaccagtctgaagcaagagatgcagaaaggaaaagac
ctggccctgacctgccagagcactacctctgtgtactcctctttcgtctttaacctgttc
acacccgagggtgccgagggcccgactccgcaaagccaacaccagctgaaggccctgtgc
tccctggctgcagagggcatgtggacagacacatttgagttttgtgaagacgacctccgg
agaaacggggttgttgacgctgacatccctgcgctgctgggcaccaagatacttctgaag
tacggggagcgtgagagctcctacgtgttcctccacgtgtgtatccaggagttctgtgcc
gccttgttctatttgctcaagagccaccttgatcatcctcacccagctgtgagatgtgta
caggaattgctagttgccaattttgaaaaagcaaggagagcacattggatttttttgggg
tgttttctaactggccttttaaataaaaaggaacaagaaaaactggatgcgttttttggc
ttccaactgtcccaagagataaagcagcaatttcaccagtgcctgaagagcttaggggag
catggcaatcctcagggacaggtggattccttggcgatattttactgtctctttgaaatg
caggatcctgcctttgtgaagcaggcagtgaacctcctccaagaagctaactttcatatt
attgacaacgtggacttggtggtttctgcctactgcttaaaatactgctccagcttgagg
aaactctgtttttccgttcaaaatgtctttaagaaagaggatgaacacagctctacgtcg
gattacagcctcgtctgttggcatcacatctgctctgtgctcaccaccagcgggcacctc
agagagctccaggtgcaggacagcaccctcagcgagtcgacctttgtgacctggtgtaac
cagctgaggcatcccagctgtcgccttcagaagcttggaataaataacgtttccttttct
ggccagagtgttctgctctttgaggtgctcttttatcagccagacttgaaatacctgagc
ttcaccctcacgaaactctctcgtgatgacatcaggtccctctgtgatgccttgaactac
ccagcaggcaacgtcaaagagctagggctggtaaattgtcacctctcacccattgattgt
gaagtccttgctggccttctaaccaacaacaagaagctgacgtatctgaatgtatcctgc
aaccagttagacacaggcgtgccccttctgtgtgaagccctgtgcagcccagacacggtc
ctggtatacctgatgttggctttctgccacctcagcgagcagtgctgccaatacatctct
gaaatgcttctgcataacaagagcgtgcgctatctagacctcagtgccaatgtcctgaag
gacgaaggactgagaactctctgcgaggccttgaaacatccggactgctgcctggattca
ctgtgtttggtaaaatgttttatcactgctgccggctgtgaagacctcgcctctgctctc
atcagcaatcaaaacctgaagattctgcaagttgggtgcaatgaaatcggagacgtgggc
gtgcagctgttgtgtcgtgctctgacgcatccggattgccgcttagagattcttgggttg
gaagaatgtgggttaacgagcacctgctgtaaggatctcgcgtctgttctcacctgcagt
aagacgctgcagcagctcaacctgaccttgaacaccttggaccacacaggggtggttgtg
ctctgtgaggccctgagacacccagagtgtgccctgcaggtgctcgggctgagaaaaact
gattttgatgaggaaacccaggcacttctgacggctgaggaagagagaaatcctaacctg
accatcacagacgactgtgacacaatcacaagggtagaaatctga

DBGET integrated database retrieval system