KEGG   Pan paniscus (bonobo): 100981507
Entry
100981507         CDS       T02283                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04066  HIF-1 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04630  JAK-STAT signaling pathway
pps04640  Hematopoietic cell lineage
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100981507 (EPO)
   04066 HIF-1 signaling pathway
    100981507 (EPO)
   04151 PI3K-Akt signaling pathway
    100981507 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100981507 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100981507 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100981507 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100981507 (EPO)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  CSF and other factors
   100981507 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100981507
NCBI-ProteinID: XP_003812952
UniProt: A0A2R9CD53
LinkDB
Position
7
AA seq 193 aa
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVRQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtccctgctgtcgctccct
ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatatcacgacgggctgtgccgaacactgc
agcttgaatgagaatatcactgtcccagacaccaaagttaatttctatgcctggaagagg
atggaggtcaggcagcaggccgtagaagtctggcagggcctggccctgctctcggaagct
gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg
catgtggataaagccgtcagtggccttcgcagcctcaccactctgcttcgggctctggga
gcccagaaggaagccatctcccctccagatgcggcctcagctgctccactccgaacaatc
actgctgacactttccgcaaactcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacaggggaggcctgcaggacaggggacagatga

DBGET integrated database retrieval system