KEGG   Pan paniscus (bonobo): 100982480
Entry
100982480         CDS       T02283                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04024  cAMP signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04137  Mitophagy - animal
pps04140  Autophagy - animal
pps04141  Protein processing in endoplasmic reticulum
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04217  Necroptosis
pps04310  Wnt signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04530  Tight junction
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04728  Dopaminergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04910  Insulin signaling pathway
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04926  Relaxin signaling pathway
pps04930  Type II diabetes mellitus
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05162  Measles
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05231  Choline metabolism in cancer
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100982480 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100982480 (MAPK8)
   04012 ErbB signaling pathway
    100982480 (MAPK8)
   04014 Ras signaling pathway
    100982480 (MAPK8)
   04310 Wnt signaling pathway
    100982480 (MAPK8)
   04668 TNF signaling pathway
    100982480 (MAPK8)
   04068 FoxO signaling pathway
    100982480 (MAPK8)
   04071 Sphingolipid signaling pathway
    100982480 (MAPK8)
   04024 cAMP signaling pathway
    100982480 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100982480 (MAPK8)
   04137 Mitophagy - animal
    100982480 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    100982480 (MAPK8)
   04215 Apoptosis - multiple species
    100982480 (MAPK8)
   04217 Necroptosis
    100982480 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100982480 (MAPK8)
   04530 Tight junction
    100982480 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100982480 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100982480 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100982480 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100982480 (MAPK8)
   04660 T cell receptor signaling pathway
    100982480 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100982480 (MAPK8)
   04659 Th17 cell differentiation
    100982480 (MAPK8)
   04657 IL-17 signaling pathway
    100982480 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100982480 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100982480 (MAPK8)
   04920 Adipocytokine signaling pathway
    100982480 (MAPK8)
   04912 GnRH signaling pathway
    100982480 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100982480 (MAPK8)
   04917 Prolactin signaling pathway
    100982480 (MAPK8)
   04926 Relaxin signaling pathway
    100982480 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    100982480 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    100982480 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100982480 (MAPK8)
   04722 Neurotrophin signaling pathway
    100982480 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100982480 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100982480 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100982480 (MAPK8)
   05231 Choline metabolism in cancer
    100982480 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100982480 (MAPK8)
   05212 Pancreatic cancer
    100982480 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100982480 (MAPK8)
   05012 Parkinson disease
    100982480 (MAPK8)
   05016 Huntington disease
    100982480 (MAPK8)
   05017 Spinocerebellar ataxia
    100982480 (MAPK8)
   05020 Prion disease
    100982480 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    100982480 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100982480 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100982480 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    100982480 (MAPK8)
   04931 Insulin resistance
    100982480 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100982480 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100982480 (MAPK8)
   05135 Yersinia infection
    100982480 (MAPK8)
   05133 Pertussis
    100982480 (MAPK8)
   05152 Tuberculosis
    100982480 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100982480 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    100982480 (MAPK8)
   05161 Hepatitis B
    100982480 (MAPK8)
   05171 Coronavirus disease - COVID-19
    100982480 (MAPK8)
   05162 Measles
    100982480 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100982480 (MAPK8)
   05169 Epstein-Barr virus infection
    100982480 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100982480 (MAPK8)
   05142 Chagas disease
    100982480 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100982480 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100982480 (MAPK8)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100982480 (MAPK8)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100982480 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 100982480
NCBI-ProteinID: XP_003809090
UniProt: A0A2R8Z8R8
LinkDB
Position
Un
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttacgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctctgatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

KEGG   Pan paniscus (bonobo): 100984173
Entry
100984173         CDS       T02283                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04024  cAMP signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04137  Mitophagy - animal
pps04140  Autophagy - animal
pps04141  Protein processing in endoplasmic reticulum
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04217  Necroptosis
pps04310  Wnt signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04530  Tight junction
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04728  Dopaminergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04910  Insulin signaling pathway
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04926  Relaxin signaling pathway
pps04930  Type II diabetes mellitus
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05162  Measles
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05231  Choline metabolism in cancer
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100984173 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100984173 (MAPK10)
   04012 ErbB signaling pathway
    100984173 (MAPK10)
   04014 Ras signaling pathway
    100984173 (MAPK10)
   04310 Wnt signaling pathway
    100984173 (MAPK10)
   04668 TNF signaling pathway
    100984173 (MAPK10)
   04068 FoxO signaling pathway
    100984173 (MAPK10)
   04071 Sphingolipid signaling pathway
    100984173 (MAPK10)
   04024 cAMP signaling pathway
    100984173 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100984173 (MAPK10)
   04137 Mitophagy - animal
    100984173 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    100984173 (MAPK10)
   04215 Apoptosis - multiple species
    100984173 (MAPK10)
   04217 Necroptosis
    100984173 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100984173 (MAPK10)
   04530 Tight junction
    100984173 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100984173 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100984173 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100984173 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100984173 (MAPK10)
   04660 T cell receptor signaling pathway
    100984173 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100984173 (MAPK10)
   04659 Th17 cell differentiation
    100984173 (MAPK10)
   04657 IL-17 signaling pathway
    100984173 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100984173 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100984173 (MAPK10)
   04920 Adipocytokine signaling pathway
    100984173 (MAPK10)
   04912 GnRH signaling pathway
    100984173 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100984173 (MAPK10)
   04917 Prolactin signaling pathway
    100984173 (MAPK10)
   04926 Relaxin signaling pathway
    100984173 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    100984173 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    100984173 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100984173 (MAPK10)
   04722 Neurotrophin signaling pathway
    100984173 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100984173 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100984173 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984173 (MAPK10)
   05231 Choline metabolism in cancer
    100984173 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100984173 (MAPK10)
   05212 Pancreatic cancer
    100984173 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100984173 (MAPK10)
   05012 Parkinson disease
    100984173 (MAPK10)
   05016 Huntington disease
    100984173 (MAPK10)
   05017 Spinocerebellar ataxia
    100984173 (MAPK10)
   05020 Prion disease
    100984173 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    100984173 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100984173 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100984173 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    100984173 (MAPK10)
   04931 Insulin resistance
    100984173 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100984173 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100984173 (MAPK10)
   05135 Yersinia infection
    100984173 (MAPK10)
   05133 Pertussis
    100984173 (MAPK10)
   05152 Tuberculosis
    100984173 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100984173 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    100984173 (MAPK10)
   05161 Hepatitis B
    100984173 (MAPK10)
   05171 Coronavirus disease - COVID-19
    100984173 (MAPK10)
   05162 Measles
    100984173 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100984173 (MAPK10)
   05169 Epstein-Barr virus infection
    100984173 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100984173 (MAPK10)
   05142 Chagas disease
    100984173 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100984173 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100984173 (MAPK10)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100984173 (MAPK10)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100984173 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100984173
NCBI-ProteinID: XP_003811293
UniProt: A0A2R9CEV4
LinkDB
Position
4
AA seq 426 aa
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAG
PLGCCR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttc
acagttctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtt
tgtgcggcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccc
tttcagaaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtg
aaccataaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggag
ttccaagatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcag
atggaattagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaag
cacctccattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaag
tctgattgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttc
atgatgactccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatg
ggctacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgc
cacaaaatcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaa
ctaggaacaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtg
gagaatcggcccaagtatgcgggactcaccttccccaaactcttcccagattccctcttc
ccagcggactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaag
atgctagtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctac
atcaacgtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaag
cagttggatgaaagagaacacacaatcgaagaatggaaagaacttatctacaaggaagta
atgaattcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggt
gcagcagtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctcc
atgtccaccgaccagaccctggcatctgacactgacagcagcctggaagcctcggcagga
cccctgggttgttgcaggtga

KEGG   Pan paniscus (bonobo): 100990080
Entry
100990080         CDS       T02283                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04024  cAMP signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04137  Mitophagy - animal
pps04140  Autophagy - animal
pps04141  Protein processing in endoplasmic reticulum
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04217  Necroptosis
pps04310  Wnt signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04530  Tight junction
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04728  Dopaminergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04910  Insulin signaling pathway
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04926  Relaxin signaling pathway
pps04930  Type II diabetes mellitus
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05162  Measles
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05231  Choline metabolism in cancer
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100990080 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100990080 (MAPK9)
   04012 ErbB signaling pathway
    100990080 (MAPK9)
   04014 Ras signaling pathway
    100990080 (MAPK9)
   04310 Wnt signaling pathway
    100990080 (MAPK9)
   04668 TNF signaling pathway
    100990080 (MAPK9)
   04068 FoxO signaling pathway
    100990080 (MAPK9)
   04071 Sphingolipid signaling pathway
    100990080 (MAPK9)
   04024 cAMP signaling pathway
    100990080 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100990080 (MAPK9)
   04137 Mitophagy - animal
    100990080 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    100990080 (MAPK9)
   04215 Apoptosis - multiple species
    100990080 (MAPK9)
   04217 Necroptosis
    100990080 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100990080 (MAPK9)
   04530 Tight junction
    100990080 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100990080 (MAPK9)
   04621 NOD-like receptor signaling pathway
    100990080 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    100990080 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    100990080 (MAPK9)
   04660 T cell receptor signaling pathway
    100990080 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    100990080 (MAPK9)
   04659 Th17 cell differentiation
    100990080 (MAPK9)
   04657 IL-17 signaling pathway
    100990080 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    100990080 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100990080 (MAPK9)
   04920 Adipocytokine signaling pathway
    100990080 (MAPK9)
   04912 GnRH signaling pathway
    100990080 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    100990080 (MAPK9)
   04917 Prolactin signaling pathway
    100990080 (MAPK9)
   04926 Relaxin signaling pathway
    100990080 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    100990080 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    100990080 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    100990080 (MAPK9)
   04722 Neurotrophin signaling pathway
    100990080 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100990080 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100990080 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100990080 (MAPK9)
   05231 Choline metabolism in cancer
    100990080 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100990080 (MAPK9)
   05212 Pancreatic cancer
    100990080 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100990080 (MAPK9)
   05012 Parkinson disease
    100990080 (MAPK9)
   05016 Huntington disease
    100990080 (MAPK9)
   05017 Spinocerebellar ataxia
    100990080 (MAPK9)
   05020 Prion disease
    100990080 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    100990080 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100990080 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100990080 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    100990080 (MAPK9)
   04931 Insulin resistance
    100990080 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100990080 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100990080 (MAPK9)
   05135 Yersinia infection
    100990080 (MAPK9)
   05133 Pertussis
    100990080 (MAPK9)
   05152 Tuberculosis
    100990080 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100990080 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    100990080 (MAPK9)
   05161 Hepatitis B
    100990080 (MAPK9)
   05171 Coronavirus disease - COVID-19
    100990080 (MAPK9)
   05162 Measles
    100990080 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100990080 (MAPK9)
   05169 Epstein-Barr virus infection
    100990080 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100990080 (MAPK9)
   05142 Chagas disease
    100990080 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100990080 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100990080 (MAPK9)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100990080 (MAPK9)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100990080 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100990080
NCBI-ProteinID: XP_003806777
LinkDB
Position
5
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaaccttc
actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaaccaaactcatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacattgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcccggacagcgtgcactaacttc
atgatgaccccttatgtggtgacacggtactaccgggcgcccgaagtcatcctgggtatg
ggctacaaagagaacgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc
cataaagtcctgttcccgggaagagactatattgatcagtggaataaagttattgagcag
ctgggaacaccatcagcagagttcatgaagaaacttcagccaactgtgaggaattatgtc
gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagattggatattc
ccatcagaatctgagcgagacaaaataaaaacaagtcaagccagagatctgttatcaaaa
atgttagtgattgatcctgacaagcggatctctgtagatgaagctctgcgtcacccatac
atcactgtttggtatgaccctgccgaagcagaagccccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcttcatcgatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtcttgatgcctcgacgggacccctt
gaaggctgtcgatga

DBGET integrated database retrieval system