Pan paniscus (bonobo): 100982480 Help Entry 100982480         CDS       T02283                                  Gene name MAPK8 Definition (RefSeq) mitogen-activated protein kinase 8   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism pps  Pan paniscus (bonobo) Pathway pps01522   Endocrine resistance pps04010   MAPK signaling pathway pps04012   ErbB signaling pathway pps04014   Ras signaling pathway pps04024   cAMP signaling pathway pps04068   FoxO signaling pathway pps04071   Sphingolipid signaling pathway pps04137   Mitophagy - animal pps04140   Autophagy - animal pps04141   Protein processing in endoplasmic reticulum pps04210   Apoptosis pps04215   Apoptosis - multiple species pps04217   Necroptosis pps04310   Wnt signaling pathway pps04380   Osteoclast differentiation pps04510   Focal adhesion pps04530   Tight junction pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04622   RIG-I-like receptor signaling pathway pps04625   C-type lectin receptor signaling pathway pps04657   IL-17 signaling pathway pps04658   Th1 and Th2 cell differentiation pps04659   Th17 cell differentiation pps04660   T cell receptor signaling pathway pps04664   Fc epsilon RI signaling pathway pps04668   TNF signaling pathway pps04722   Neurotrophin signaling pathway pps04723   Retrograde endocannabinoid signaling pps04728   Dopaminergic synapse pps04750   Inflammatory mediator regulation of TRP channels pps04910   Insulin signaling pathway pps04912   GnRH signaling pathway pps04914   Progesterone-mediated oocyte maturation pps04917   Prolactin signaling pathway pps04920   Adipocytokine signaling pathway pps04926   Relaxin signaling pathway pps04930   Type II diabetes mellitus pps04931   Insulin resistance pps04932   Non-alcoholic fatty liver disease pps04933   AGE-RAGE signaling pathway in diabetic complications pps04935   Growth hormone synthesis, secretion and action pps05010   Alzheimer disease pps05012   Parkinson disease pps05016   Huntington disease pps05017   Spinocerebellar ataxia pps05020   Prion disease pps05022   Pathways of neurodegeneration - multiple diseases pps05132   Salmonella infection pps05133   Pertussis pps05135   Yersinia infection pps05142   Chagas disease pps05145   Toxoplasmosis pps05152   Tuberculosis pps05161   Hepatitis B pps05162   Measles pps05166   Human T-cell leukemia virus 1 infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05171   Coronavirus disease - COVID-19 pps05200   Pathways in cancer pps05210   Colorectal cancer pps05212   Pancreatic cancer pps05231   Choline metabolism in cancer pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100982480 (MAPK8)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100982480 (MAPK8)    04012 ErbB signaling pathway     100982480 (MAPK8)    04014 Ras signaling pathway     100982480 (MAPK8)    04310 Wnt signaling pathway     100982480 (MAPK8)    04668 TNF signaling pathway     100982480 (MAPK8)    04068 FoxO signaling pathway     100982480 (MAPK8)    04071 Sphingolipid signaling pathway     100982480 (MAPK8)    04024 cAMP signaling pathway     100982480 (MAPK8)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100982480 (MAPK8)    04137 Mitophagy - animal     100982480 (MAPK8)   09143 Cell growth and death    04210 Apoptosis     100982480 (MAPK8)    04215 Apoptosis - multiple species     100982480 (MAPK8)    04217 Necroptosis     100982480 (MAPK8)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100982480 (MAPK8)    04530 Tight junction     100982480 (MAPK8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100982480 (MAPK8)    04621 NOD-like receptor signaling pathway     100982480 (MAPK8)    04622 RIG-I-like receptor signaling pathway     100982480 (MAPK8)    04625 C-type lectin receptor signaling pathway     100982480 (MAPK8)    04660 T cell receptor signaling pathway     100982480 (MAPK8)    04658 Th1 and Th2 cell differentiation     100982480 (MAPK8)    04659 Th17 cell differentiation     100982480 (MAPK8)    04657 IL-17 signaling pathway     100982480 (MAPK8)    04664 Fc epsilon RI signaling pathway     100982480 (MAPK8)   09152 Endocrine system    04910 Insulin signaling pathway     100982480 (MAPK8)    04920 Adipocytokine signaling pathway     100982480 (MAPK8)    04912 GnRH signaling pathway     100982480 (MAPK8)    04914 Progesterone-mediated oocyte maturation     100982480 (MAPK8)    04917 Prolactin signaling pathway     100982480 (MAPK8)    04926 Relaxin signaling pathway     100982480 (MAPK8)    04935 Growth hormone synthesis, secretion and action     100982480 (MAPK8)   09156 Nervous system    04728 Dopaminergic synapse     100982480 (MAPK8)    04723 Retrograde endocannabinoid signaling     100982480 (MAPK8)    04722 Neurotrophin signaling pathway     100982480 (MAPK8)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100982480 (MAPK8)   09158 Development and regeneration    04380 Osteoclast differentiation     100982480 (MAPK8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100982480 (MAPK8)    05231 Choline metabolism in cancer     100982480 (MAPK8)   09162 Cancer: specific types    05210 Colorectal cancer     100982480 (MAPK8)    05212 Pancreatic cancer     100982480 (MAPK8)   09164 Neurodegenerative disease    05010 Alzheimer disease     100982480 (MAPK8)    05012 Parkinson disease     100982480 (MAPK8)    05016 Huntington disease     100982480 (MAPK8)    05017 Spinocerebellar ataxia     100982480 (MAPK8)    05020 Prion disease     100982480 (MAPK8)    05022 Pathways of neurodegeneration - multiple diseases     100982480 (MAPK8)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100982480 (MAPK8)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100982480 (MAPK8)    04932 Non-alcoholic fatty liver disease     100982480 (MAPK8)    04931 Insulin resistance     100982480 (MAPK8)    04933 AGE-RAGE signaling pathway in diabetic complications     100982480 (MAPK8)   09171 Infectious disease: bacterial    05132 Salmonella infection     100982480 (MAPK8)    05135 Yersinia infection     100982480 (MAPK8)    05133 Pertussis     100982480 (MAPK8)    05152 Tuberculosis     100982480 (MAPK8)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100982480 (MAPK8)    05170 Human immunodeficiency virus 1 infection     100982480 (MAPK8)    05161 Hepatitis B     100982480 (MAPK8)    05171 Coronavirus disease - COVID-19     100982480 (MAPK8)    05162 Measles     100982480 (MAPK8)    05167 Kaposi sarcoma-associated herpesvirus infection     100982480 (MAPK8)    05169 Epstein-Barr virus infection     100982480 (MAPK8)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100982480 (MAPK8)    05142 Chagas disease     100982480 (MAPK8)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100982480 (MAPK8)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:pps01001]     100982480 (MAPK8) Enzymes [BR:pps01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100982480 (MAPK8) Protein kinases [BR:pps01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100982480 (MAPK8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530 Motif Other DBs NCBI-GeneID:  100982480 NCBI-ProteinID:  XP_003809090 UniProt:  A0A2R8Z8R8 LinkDB All DBs Position Un AA seq 427 aa AA seqDB search MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA GPLGCCR NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt atgatgacgccttacgtagtgactcgctactacagagcacccgaggtcatccttggcatg ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct tcaatgtcaacagatccgactttggcctctgatacagacagcagtctagaagcatcagct gggcctctgggctgctgtagatga

Pan paniscus (bonobo): 100984173 Help Entry 100984173         CDS       T02283                                  Gene name MAPK10 Definition (RefSeq) mitogen-activated protein kinase 10   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism pps  Pan paniscus (bonobo) Pathway pps01522   Endocrine resistance pps04010   MAPK signaling pathway pps04012   ErbB signaling pathway pps04014   Ras signaling pathway pps04024   cAMP signaling pathway pps04068   FoxO signaling pathway pps04071   Sphingolipid signaling pathway pps04137   Mitophagy - animal pps04140   Autophagy - animal pps04141   Protein processing in endoplasmic reticulum pps04210   Apoptosis pps04215   Apoptosis - multiple species pps04217   Necroptosis pps04310   Wnt signaling pathway pps04380   Osteoclast differentiation pps04510   Focal adhesion pps04530   Tight junction pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04622   RIG-I-like receptor signaling pathway pps04625   C-type lectin receptor signaling pathway pps04657   IL-17 signaling pathway pps04658   Th1 and Th2 cell differentiation pps04659   Th17 cell differentiation pps04660   T cell receptor signaling pathway pps04664   Fc epsilon RI signaling pathway pps04668   TNF signaling pathway pps04722   Neurotrophin signaling pathway pps04723   Retrograde endocannabinoid signaling pps04728   Dopaminergic synapse pps04750   Inflammatory mediator regulation of TRP channels pps04910   Insulin signaling pathway pps04912   GnRH signaling pathway pps04914   Progesterone-mediated oocyte maturation pps04917   Prolactin signaling pathway pps04920   Adipocytokine signaling pathway pps04926   Relaxin signaling pathway pps04930   Type II diabetes mellitus pps04931   Insulin resistance pps04932   Non-alcoholic fatty liver disease pps04933   AGE-RAGE signaling pathway in diabetic complications pps04935   Growth hormone synthesis, secretion and action pps05010   Alzheimer disease pps05012   Parkinson disease pps05016   Huntington disease pps05017   Spinocerebellar ataxia pps05020   Prion disease pps05022   Pathways of neurodegeneration - multiple diseases pps05132   Salmonella infection pps05133   Pertussis pps05135   Yersinia infection pps05142   Chagas disease pps05145   Toxoplasmosis pps05152   Tuberculosis pps05161   Hepatitis B pps05162   Measles pps05166   Human T-cell leukemia virus 1 infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05171   Coronavirus disease - COVID-19 pps05200   Pathways in cancer pps05210   Colorectal cancer pps05212   Pancreatic cancer pps05231   Choline metabolism in cancer pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100984173 (MAPK10)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100984173 (MAPK10)    04012 ErbB signaling pathway     100984173 (MAPK10)    04014 Ras signaling pathway     100984173 (MAPK10)    04310 Wnt signaling pathway     100984173 (MAPK10)    04668 TNF signaling pathway     100984173 (MAPK10)    04068 FoxO signaling pathway     100984173 (MAPK10)    04071 Sphingolipid signaling pathway     100984173 (MAPK10)    04024 cAMP signaling pathway     100984173 (MAPK10)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100984173 (MAPK10)    04137 Mitophagy - animal     100984173 (MAPK10)   09143 Cell growth and death    04210 Apoptosis     100984173 (MAPK10)    04215 Apoptosis - multiple species     100984173 (MAPK10)    04217 Necroptosis     100984173 (MAPK10)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100984173 (MAPK10)    04530 Tight junction     100984173 (MAPK10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100984173 (MAPK10)    04621 NOD-like receptor signaling pathway     100984173 (MAPK10)    04622 RIG-I-like receptor signaling pathway     100984173 (MAPK10)    04625 C-type lectin receptor signaling pathway     100984173 (MAPK10)    04660 T cell receptor signaling pathway     100984173 (MAPK10)    04658 Th1 and Th2 cell differentiation     100984173 (MAPK10)    04659 Th17 cell differentiation     100984173 (MAPK10)    04657 IL-17 signaling pathway     100984173 (MAPK10)    04664 Fc epsilon RI signaling pathway     100984173 (MAPK10)   09152 Endocrine system    04910 Insulin signaling pathway     100984173 (MAPK10)    04920 Adipocytokine signaling pathway     100984173 (MAPK10)    04912 GnRH signaling pathway     100984173 (MAPK10)    04914 Progesterone-mediated oocyte maturation     100984173 (MAPK10)    04917 Prolactin signaling pathway     100984173 (MAPK10)    04926 Relaxin signaling pathway     100984173 (MAPK10)    04935 Growth hormone synthesis, secretion and action     100984173 (MAPK10)   09156 Nervous system    04728 Dopaminergic synapse     100984173 (MAPK10)    04723 Retrograde endocannabinoid signaling     100984173 (MAPK10)    04722 Neurotrophin signaling pathway     100984173 (MAPK10)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100984173 (MAPK10)   09158 Development and regeneration    04380 Osteoclast differentiation     100984173 (MAPK10)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100984173 (MAPK10)    05231 Choline metabolism in cancer     100984173 (MAPK10)   09162 Cancer: specific types    05210 Colorectal cancer     100984173 (MAPK10)    05212 Pancreatic cancer     100984173 (MAPK10)   09164 Neurodegenerative disease    05010 Alzheimer disease     100984173 (MAPK10)    05012 Parkinson disease     100984173 (MAPK10)    05016 Huntington disease     100984173 (MAPK10)    05017 Spinocerebellar ataxia     100984173 (MAPK10)    05020 Prion disease     100984173 (MAPK10)    05022 Pathways of neurodegeneration - multiple diseases     100984173 (MAPK10)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100984173 (MAPK10)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100984173 (MAPK10)    04932 Non-alcoholic fatty liver disease     100984173 (MAPK10)    04931 Insulin resistance     100984173 (MAPK10)    04933 AGE-RAGE signaling pathway in diabetic complications     100984173 (MAPK10)   09171 Infectious disease: bacterial    05132 Salmonella infection     100984173 (MAPK10)    05135 Yersinia infection     100984173 (MAPK10)    05133 Pertussis     100984173 (MAPK10)    05152 Tuberculosis     100984173 (MAPK10)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100984173 (MAPK10)    05170 Human immunodeficiency virus 1 infection     100984173 (MAPK10)    05161 Hepatitis B     100984173 (MAPK10)    05171 Coronavirus disease - COVID-19     100984173 (MAPK10)    05162 Measles     100984173 (MAPK10)    05167 Kaposi sarcoma-associated herpesvirus infection     100984173 (MAPK10)    05169 Epstein-Barr virus infection     100984173 (MAPK10)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100984173 (MAPK10)    05142 Chagas disease     100984173 (MAPK10)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100984173 (MAPK10)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:pps01001]     100984173 (MAPK10) Enzymes [BR:pps01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100984173 (MAPK10) Protein kinases [BR:pps01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100984173 (MAPK10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 Motif Other DBs NCBI-GeneID:  100984173 NCBI-ProteinID:  XP_003811293 UniProt:  A0A2R9CEV4 LinkDB All DBs Position 4 AA seq 426 aa AA seqDB search MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAG PLGCCR NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt atgagcaaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttc acagttctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtt tgtgcggcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccc tttcagaaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtg aaccataaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggag ttccaagatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcag atggaattagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaag cacctccattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaag tctgattgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttc atgatgactccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatg ggctacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgc cacaaaatcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaa ctaggaacaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtg gagaatcggcccaagtatgcgggactcaccttccccaaactcttcccagattccctcttc ccagcggactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaag atgctagtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctac atcaacgtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaag cagttggatgaaagagaacacacaatcgaagaatggaaagaacttatctacaaggaagta atgaattcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggt gcagcagtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctcc atgtccaccgaccagaccctggcatctgacactgacagcagcctggaagcctcggcagga cccctgggttgttgcaggtga

Pan paniscus (bonobo): 100990080 Help Entry 100990080         CDS       T02283                                  Gene name MAPK9 Definition (RefSeq) mitogen-activated protein kinase 9   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism pps  Pan paniscus (bonobo) Pathway pps01522   Endocrine resistance pps04010   MAPK signaling pathway pps04012   ErbB signaling pathway pps04014   Ras signaling pathway pps04024   cAMP signaling pathway pps04068   FoxO signaling pathway pps04071   Sphingolipid signaling pathway pps04137   Mitophagy - animal pps04140   Autophagy - animal pps04141   Protein processing in endoplasmic reticulum pps04210   Apoptosis pps04215   Apoptosis - multiple species pps04217   Necroptosis pps04310   Wnt signaling pathway pps04380   Osteoclast differentiation pps04510   Focal adhesion pps04530   Tight junction pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04622   RIG-I-like receptor signaling pathway pps04625   C-type lectin receptor signaling pathway pps04657   IL-17 signaling pathway pps04658   Th1 and Th2 cell differentiation pps04659   Th17 cell differentiation pps04660   T cell receptor signaling pathway pps04664   Fc epsilon RI signaling pathway pps04668   TNF signaling pathway pps04722   Neurotrophin signaling pathway pps04723   Retrograde endocannabinoid signaling pps04728   Dopaminergic synapse pps04750   Inflammatory mediator regulation of TRP channels pps04910   Insulin signaling pathway pps04912   GnRH signaling pathway pps04914   Progesterone-mediated oocyte maturation pps04917   Prolactin signaling pathway pps04920   Adipocytokine signaling pathway pps04926   Relaxin signaling pathway pps04930   Type II diabetes mellitus pps04931   Insulin resistance pps04932   Non-alcoholic fatty liver disease pps04933   AGE-RAGE signaling pathway in diabetic complications pps04935   Growth hormone synthesis, secretion and action pps05010   Alzheimer disease pps05012   Parkinson disease pps05016   Huntington disease pps05017   Spinocerebellar ataxia pps05020   Prion disease pps05022   Pathways of neurodegeneration - multiple diseases pps05132   Salmonella infection pps05133   Pertussis pps05135   Yersinia infection pps05142   Chagas disease pps05145   Toxoplasmosis pps05152   Tuberculosis pps05161   Hepatitis B pps05162   Measles pps05166   Human T-cell leukemia virus 1 infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05171   Coronavirus disease - COVID-19 pps05200   Pathways in cancer pps05210   Colorectal cancer pps05212   Pancreatic cancer pps05231   Choline metabolism in cancer pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100990080 (MAPK9)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100990080 (MAPK9)    04012 ErbB signaling pathway     100990080 (MAPK9)    04014 Ras signaling pathway     100990080 (MAPK9)    04310 Wnt signaling pathway     100990080 (MAPK9)    04668 TNF signaling pathway     100990080 (MAPK9)    04068 FoxO signaling pathway     100990080 (MAPK9)    04071 Sphingolipid signaling pathway     100990080 (MAPK9)    04024 cAMP signaling pathway     100990080 (MAPK9)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100990080 (MAPK9)    04137 Mitophagy - animal     100990080 (MAPK9)   09143 Cell growth and death    04210 Apoptosis     100990080 (MAPK9)    04215 Apoptosis - multiple species     100990080 (MAPK9)    04217 Necroptosis     100990080 (MAPK9)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100990080 (MAPK9)    04530 Tight junction     100990080 (MAPK9)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100990080 (MAPK9)    04621 NOD-like receptor signaling pathway     100990080 (MAPK9)    04622 RIG-I-like receptor signaling pathway     100990080 (MAPK9)    04625 C-type lectin receptor signaling pathway     100990080 (MAPK9)    04660 T cell receptor signaling pathway     100990080 (MAPK9)    04658 Th1 and Th2 cell differentiation     100990080 (MAPK9)    04659 Th17 cell differentiation     100990080 (MAPK9)    04657 IL-17 signaling pathway     100990080 (MAPK9)    04664 Fc epsilon RI signaling pathway     100990080 (MAPK9)   09152 Endocrine system    04910 Insulin signaling pathway     100990080 (MAPK9)    04920 Adipocytokine signaling pathway     100990080 (MAPK9)    04912 GnRH signaling pathway     100990080 (MAPK9)    04914 Progesterone-mediated oocyte maturation     100990080 (MAPK9)    04917 Prolactin signaling pathway     100990080 (MAPK9)    04926 Relaxin signaling pathway     100990080 (MAPK9)    04935 Growth hormone synthesis, secretion and action     100990080 (MAPK9)   09156 Nervous system    04728 Dopaminergic synapse     100990080 (MAPK9)    04723 Retrograde endocannabinoid signaling     100990080 (MAPK9)    04722 Neurotrophin signaling pathway     100990080 (MAPK9)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100990080 (MAPK9)   09158 Development and regeneration    04380 Osteoclast differentiation     100990080 (MAPK9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100990080 (MAPK9)    05231 Choline metabolism in cancer     100990080 (MAPK9)   09162 Cancer: specific types    05210 Colorectal cancer     100990080 (MAPK9)    05212 Pancreatic cancer     100990080 (MAPK9)   09164 Neurodegenerative disease    05010 Alzheimer disease     100990080 (MAPK9)    05012 Parkinson disease     100990080 (MAPK9)    05016 Huntington disease     100990080 (MAPK9)    05017 Spinocerebellar ataxia     100990080 (MAPK9)    05020 Prion disease     100990080 (MAPK9)    05022 Pathways of neurodegeneration - multiple diseases     100990080 (MAPK9)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100990080 (MAPK9)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100990080 (MAPK9)    04932 Non-alcoholic fatty liver disease     100990080 (MAPK9)    04931 Insulin resistance     100990080 (MAPK9)    04933 AGE-RAGE signaling pathway in diabetic complications     100990080 (MAPK9)   09171 Infectious disease: bacterial    05132 Salmonella infection     100990080 (MAPK9)    05135 Yersinia infection     100990080 (MAPK9)    05133 Pertussis     100990080 (MAPK9)    05152 Tuberculosis     100990080 (MAPK9)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100990080 (MAPK9)    05170 Human immunodeficiency virus 1 infection     100990080 (MAPK9)    05161 Hepatitis B     100990080 (MAPK9)    05171 Coronavirus disease - COVID-19     100990080 (MAPK9)    05162 Measles     100990080 (MAPK9)    05167 Kaposi sarcoma-associated herpesvirus infection     100990080 (MAPK9)    05169 Epstein-Barr virus infection     100990080 (MAPK9)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100990080 (MAPK9)    05142 Chagas disease     100990080 (MAPK9)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100990080 (MAPK9)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:pps01001]     100990080 (MAPK9) Enzymes [BR:pps01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100990080 (MAPK9) Protein kinases [BR:pps01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100990080 (MAPK9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 Motif Other DBs NCBI-GeneID:  100990080 NCBI-ProteinID:  XP_003806777 LinkDB All DBs Position 5 AA seq 424 aa AA seqDB search MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL EGCR NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaaccttc actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct tttcagaaccaaactcatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa catctgcattcagctggtataattcatagagatttgaagcctagcaacattgttgtgaaa tcagactgcaccctgaagatccttgactttggcctggcccggacagcgtgcactaacttc atgatgaccccttatgtggtgacacggtactaccgggcgcccgaagtcatcctgggtatg ggctacaaagagaacgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc cataaagtcctgttcccgggaagagactatattgatcagtggaataaagttattgagcag ctgggaacaccatcagcagagttcatgaagaaacttcagccaactgtgaggaattatgtc gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagattggatattc ccatcagaatctgagcgagacaaaataaaaacaagtcaagccagagatctgttatcaaaa atgttagtgattgatcctgacaagcggatctctgtagatgaagctctgcgtcacccatac atcactgtttggtatgaccctgccgaagcagaagccccaccacctcaaatttatgatgcc cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca gtaagtagcaacgccactccttctcagtcttcatcgatcaatgacatttcatccatgtcc actgagcagacgctggcctcagacacagacagcagtcttgatgcctcgacgggacccctt gaaggctgtcgatga

DBGET integrated database retrieval system