KEGG   Pan paniscus (bonobo): 100993705Help
Entry
100993705         CDS       T02283                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00590  Arachidonic acid metabolism
pps01100  Metabolic pathways
pps04611  Platelet activation
pps04726  Serotonergic synapse
pps04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100993705 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100993705 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100993705 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    100993705 (PTGS1)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100993705 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100993705
NCBI-ProteinID: XP_003833169
LinkDB All DBs
Position
9
AA seq 599 aa AA seqDB search
MSRSLLLRFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIRIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKMGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHVLHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagccggagtctcttgctccggttcttgctgttcctgctcctgctcccgccgctcccc
gtcctgctcgcggacccaggggcgcccacgccagtgaatccctgttgttactatccatgc
cagcaccagggcatctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgc
acgggctattccggccccaactgcaccatccctggcctgtggacctggctccggaattca
ctgcggcccagcccctctttcacccacttcctgctcactcacgggcgctggttctgggag
tttgtcaatgccaccttcatccgagagatgctcatgcgcctggtactcacagtgcgctcc
aaccttatccccagtccccccacctacaactcagcacatgactacatcagctgggagtct
ttctccaacgtgagctattacactcgtattctgccctctgtgcctaaagattgccccaca
cccatgggaaccaaagggaagaagcagttgccagatgcccagctcctggcccgccgcttc
ctgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggccacatttatggagacaatctggagcgtcag
tatcaactgcggctctttaaggatgggaaactcaagtaccaggtgctggacggagaaatg
tacccgccctcggtagaagaggcgcctgtgttgatgcactacccccgaggcatcccgccc
cagagccagatggctgtgggccaggaggtgtttgggctgcttcctgggctcatgctgtat
gccacgctctggctacgtgagcacaaccgtgtgtgtgacctgctgaaggctgagcacccc
acctggggcgatgagcagcttttccagacgacccgcctcatcctcataggggagaccatc
aggattgtcatcgaggagtacgtgcagcagctgagtggctatttcctgcagctgaaattt
gacccagagctgctgttcggtgtccagttccaataccgcaaccgcattgccatggagttc
aaccatctctaccactggcaccccctcatgcctgactccttcaagatgggctcccaggag
tacagctacgagcagttcttgttcaacacctccatgttggtggactatggggtcgaggcc
ctggtggatgccttctctcgccagattgctggccggatcggtgggggcaggaacatggac
caccatgtcctgcacgtggctgtggatgtcatcagggagtctcgggagatgcggctgcag
cccttcaatgagtaccgcaagaggtttggcatgaaaccctacacctccttccaggagctc
gtaggagagaaggagatggcagcagagttggaggaattgtatggagacattgatgcgttg
gagttctaccctggactgcttcttgaaaagtgccatccaaactctatctttggggagagt
atgatagagattggggctcccttttccctcaagggtctcctagggaatcccatctgttct
ccggagtactggaagccgagcacatttggcggcgaggtgggctttaacatcgtcaagacg
gccacactgaagaagctggtctgcctcaacaccaagacctgtccctacgtttccttccgt
gtgccggatgccagtcaggatgatgggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system