KEGG   Paenibacillus psychroresistens: EHS13_01510
Entry
EHS13_01510       CDS       T06328                                 

Gene name
mfd
Definition
(GenBank) transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_01510 (mfd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_01510 (mfd)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     EHS13_01510 (mfd)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      EHS13_01510 (mfd)
SSDB
Motif
Pfam: CarD_CdnL_TRCF UvrB_inter TRCF Helicase_C DEAD ResIII SNF2_N DUF2288 AAA_22
Other DBs
NCBI-ProteinID: QGQ93688
UniProt: A0A6B8RDZ6
LinkDB
Position
300249..303770
AA seq 1173 aa
MKQLIKAFSEDMDFQTIVSGFKSGMREQLVSGLSGSSRQVMISAMKEQLNQPIVILTHNM
FSAQKIAEDLIECLSAEEVLLYPAQELMLTEAAIASPELLAQRIDALSRLASGFRGIFIT
PFAGLRKLLPLSEIYTEAQIHISVGETLQVEDFLLKMTEIGYERVERVEAKGEMSVRGGI
IDVFPLTAETPYRIELFDVEVDSIRSFDVVDQRSIEKLTNLTILPCKEIIADQRRYKNAA
QHASELLQQQLEKMTDKQAKTKLKEEIGHEIAQLEQHHHFPSIYKYISLLYPERQTLLDY
VAKDSLLLIDEPARLLETSKQMERDEAELITNLLQEGKCLPSFVMAKTYDTLLHRKPFPT
LYLSLFLRQVPQTQPQNIVNFMCRSMQNFHGQMNLLKAEMDRWKKTGCTVLLLTNGDERM
ERIKRILQDYQIDEPILLNGNLQSGFELPSIRLVVVTEGELFTQKQRKVRKMDKKIENAE
RIKNYQELKVGDHVVHVNHGIGKYIGIGTLEINGMHKDYLHILYAGGDKLSVPIDQFDLI
QKYVGSEEKEPKVYKLGGSDWARVKSKVRSTVKDIADELIQLYAERQATTGYGFNPDTPY
QSEFEDLFPYDETRDQLRAIDEIKKDMEKPRPMDRLLCGDVGYGKTEVAIRAAFKASIDG
KQVAVLVPTTILAQQHYATFRERFSGYPIQIQVLSRFRSKKEQTETIKGIKKGTVDVVIG
THRLLSSDIQFKELGLLIVDEEQRFGVSHKEKLKRLKMDVDVLTLTATPIPRTLHMSMLG
VRDLSVIETPPENRFPVQTYVVEHSFALAREAIERELAREGQVYYLFNRVQGIHQIAEQL
SMLVPDARVAVAHGQMPEQELERTILDFLEGEYDVLVSTSIIETGVDIPNVNTLIVHDAD
KMGLSQLYQLRGRVGRSNRIAYAYFTYQRDKILNEVAEKRLQAIKEFTELGSGFKIAMRD
LSIRGAGNLLGAEQHGFIASVGFDLYSQMLAQEIATRKAEMGGEAKVEAKPWSTLLELQI
DAYLPSDYIYDSMQKIEIYKKVVNLTTIEEVADLHEELVDRFGDLPAAVDNLLAVARIKV
YGSLYAIESISQKGDDYQIKIHTEQSGNIDGKKLVALSTQFEGRLKVIPGPHILIELRCK
NLAADQAVQLLERFLHGYQDVLKTKGELQNVAK
NT seq 3522 nt   +upstreamnt  +downstreamnt
ttgaagcaattaattaaagctttttcagaggatatggattttcaaacgatcgtttcaggg
ttcaaatcgggtatgcgggagcagctcgtttcagggttgtccggttcatcacgacaagtc
atgataagtgcaatgaaagagcagcttaaccagcctatcgtgattctcacacataatatg
ttctctgcccagaagattgccgaagatctaattgaatgtctttctgcggaagaagttctg
ttataccctgcacaagaattgatgttaacagaagcggctattgctagcccagagcttcta
gctcaacgaatcgacgcattaagtagattggcgagcggctttcgtggtatttttattacc
ccttttgccggattgaggaagctgcttcctctaagtgagatttacacagaagcacaaatc
catatttccgttggggaaactttgcaggttgaagatttcttattgaaaatgacggaaatc
ggctatgaacgagttgaaagagttgaagccaaaggtgaaatgagtgtgcgtggaggcatt
attgacgtatttccgctgactgcagagactccatatcgaatagagctttttgatgtagag
gttgactctatacgcagctttgatgttgtggatcagcgctcgatcgagaagttaactaat
ctaaccattcttccctgcaaagaaataatagccgatcaaagaaggtataagaacgcggca
cagcatgcatcggagctattgcagcagcaattagagaaaatgaccgataaacaagcgaag
actaagctaaaagaagaaattggccatgaaatagcgcagctggaacagcatcaccacttt
cccagcatttataaatacatttctttgttgtacccggaacggcaaaccttgctagattat
gtagctaaagatagcttgctcttgattgatgaaccagcgcgtttactggaaacctcgaag
cagatggagcgggatgaagctgaattaataaccaacctattgcaagagggtaaatgcttg
ccttcttttgtgatggctaaaacttacgataccctattgcatcgcaagccatttccgaca
ctctatctctcgcttttcttgcgtcaggtaccgcaaactcagccgcagaatatcgtaaac
tttatgtgccgctcgatgcagaatttccatgggcagatgaatttactcaaagcggaaatg
gaccgttggaagaaaacaggctgtaccgtattgctgctcactaacggtgatgagcggatg
gagcggattaagcgtattctgcaggattatcaaattgatgagcctattctgttaaatggc
aatttgcaaagcgggtttgagctgccttctattcggcttgttgttgtaaccgaaggggaa
ttatttactcaaaagcaacgcaaggttcggaagatggataaaaaaattgaaaatgcagag
cggattaagaattatcaagaattgaaggtcggcgatcatgttgttcatgtcaatcatggg
attggtaagtacataggcattggcaccttagaaatcaacgggatgcacaaggattacttg
catattctttatgcgggtggcgataagctgtctgtacctattgaccagtttgatttgatt
caaaaatatgtgggatcggaagagaaagagcctaaggtttataaattaggcggatccgac
tgggcacgggttaagagtaaggttcgttcaacagtcaaggatattgctgatgaattgatt
cagctctacgcggaacgccaagcaacaaccggttatggatttaatccggataccccttat
caaagtgagtttgaagacttgtttccatacgatgaaacaagagaccaattgcgcgccatt
gacgagatcaagaaagatatggaaaaaccacgtccgatggatcgtttattatgcggcgat
gtgggttatgggaaaacggaagtcgccatacgtgcagcttttaaagcttctattgatggc
aaacaagtcgctgtgcttgtacctactacgattctggctcaacagcactatgcaacattt
cgcgagcgattctccggttatccaatccaaatccaagtgctcagccgttttcgctccaaa
aaagagcaaaccgagacgatcaaagggattaaaaaagggacagtcgatgtcgtcatcggc
acacatcggttgctttccagtgatattcaatttaaagaattgggtttgctgatcgtagat
gaagaacagcgttttggcgtctcccataaagaaaaacttaaacggttgaagatggatgtg
gatgttctcactctaacagctacaccgatcccgagaactctgcatatgtctatgttaggt
gttagggatctgtccgtgattgaaacgcctccggagaatcgttttccggtgcaaacctat
gtcgtcgagcacagctttgctttggccagagaagcgattgagcgagagctggctcgcgaa
gggcaagtctactatttattcaatcgtgtccaaggcatacatcagattgcagagcagctt
tccatgcttgttcccgatgccagagtagctgtagcccacggtcaaatgcctgaacaagag
ctagagcgcacgattctcgactttctggaaggcgaatatgatgtcttggttagtacgagt
attattgaaacaggcgtggatatacccaatgtaaatacgctgattgttcatgatgcagat
aagatggggctgtcccaactctatcagctgcgtggacgtgtcggtcggtccaatagaatt
gcttatgcctattttacttaccaacgggataaaatattaaatgaagttgcggagaagcgg
ctgcaggcgatcaaagagtttactgagctgggttccgggttcaaaattgctatgcgagat
ttatctattcgcggagcaggtaatttattgggagcggagcagcatgggtttattgcttct
gttggctttgatctttattcgcaaatgctcgcacaagaaatcgccacgcgtaaagcggaa
atgggcggtgaagccaaggtagaagccaaaccatggagtacattgctagagctgcaaatt
gatgcctatttaccttcggactacatttatgatagtatgcagaagattgagatttataaa
aaagtagttaatttaacaactatagaagaagtggcggacctgcatgaggaattggttgat
cgattcggagatttgcctgcagcggttgataacttgctggcggttgcaagaattaaagtt
tacggatccttgtatgccattgaatcgataagtcaaaaaggggatgattaccagattaaa
atccatacagagcaaagtgggaatatcgatgggaaaaaactggtagcgctatctactcaa
tttgagggcagattaaaggtcattccaggtccacatatccttatagaattacgctgcaag
aatctagctgcagatcaagctgtccaattattggagagattcctgcacggctatcaagat
gtacttaaaacaaaaggagagttgcaaaatgttgccaaataa

DBGET integrated database retrieval system