KEGG   Paenibacillus psychroresistens: EHS13_03420
Entry
EHS13_03420       CDS       T06328                                 

Definition
(GenBank) DNA-3-methyladenine glycosylase 2
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHS13_03420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_03420
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     EHS13_03420
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EHS13_03420
SSDB
Motif
Pfam: HhH-GPD OGG_N AlkA_N PRiA4_ORF3
Other DBs
NCBI-ProteinID: QGQ94026
UniProt: A0A6B8RF89
LinkDB
Position
700134..701063
AA seq 309 aa
MQQSGFNDKWREQETEISCSLPIEFSMQQTLFYLTRSINECLHRVQDGRVYKLILIDNEP
ILIEVAVSEDHRLNIKFINCKPSHQTRVQTALYVWDWFDLETDLTQFYQLAEADPILHKL
VKSHYGLRITGIPDLFEALCWAIMGQQINLAFAYSLKKRFVESFGAGLEWEGNQYWLFPT
TAQIASLAVEDLTKLQLTGKKAEYIIDLAKLIERGELSKQQLLAMGDFKEAEKAMVSIRG
IGPWTANYVMMRCLRDKAAFPLEDVGLHNALKKQLQLEQKPTLAEIRKHAMGWAQWEAYA
TFYLWKSLD
NT seq 930 nt   +upstreamnt  +downstreamnt
atgcaacaaagtggctttaatgataaatggagggagcaagaaaccgaaatttcttgctcc
cttcccattgaatttagtatgcagcaaaccctattttacttaacgcgttctatcaatgaa
tgcttgcatcgtgtacaggacggaagagtatacaagctgatcttaatagacaatgaacct
atattgatagaggttgcggtatcagaggatcatcgcttaaatatcaaattcattaactgc
aagccaagtcatcagacgcgcgtccaaactgccttatatgtatgggactggtttgattta
gaaacagatttaactcagttctatcagttggctgaagcagatccgatcctacataaactt
gtaaaatcacattatggcttgcggataacaggtattcctgatttattcgaagcgctttgc
tgggcgattatggggcagcagattaatttagcttttgcctactcgcttaagaaacgtttt
gtcgaaagctttggtgctggtttagagtgggagggaaatcagtattggttattcccaact
acagcacaaattgctagtctagcagttgaagatttaacaaagctgcagcttacaggtaaa
aaagcagagtatattattgacttagcgaagttaatagagcgtggtgagcttagcaaacag
cagctattggcaatgggcgatttcaaggaagcggagaaagcgatggttagcattcgcggg
attggtccttggacggctaactatgtaatgatgagatgtttacgcgataaagcagcattt
ccgttggaggacgttggtttgcataatgcattaaagaagcaattacagcttgagcagaag
ccaaccctcgcagaaattcgcaagcatgcaatgggctgggctcaatgggaggcctatgct
actttttacttatggaaaagcttagattag

DBGET integrated database retrieval system