KEGG   Paenibacillus psychroresistens: EHS13_03950
Entry
EHS13_03950       CDS       T06328                                 

Definition
(GenBank) DNA helicase UvrD
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_03950
   03430 Mismatch repair
    EHS13_03950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_03950
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_03950
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHS13_03950
   MMR (mismatch excision repair)
    Other MMR factors
     EHS13_03950
SSDB
Motif
Pfam: UvrD_C AAA_19 UvrD-helicase UvrD_C_2 Viral_helicase1 DUF2075 PhoH AAA_30 NACHT T2SSE AAA_16 ResIII DEAD DUF1726
Other DBs
NCBI-ProteinID: QGQ94118
UniProt: A0A6B8RFB8
LinkDB
Position
832033..834186
AA seq 717 aa
MLDQTQSAYQDELKQLKKTTDEIDKQLQKIVETPRYFGQDLTEQVLDLNREVKREHLQKA
SAEPYFGRLDYQEIGKTQPFPLYIGKNGVENDKTHELLVIDWRAPVASLFYSFTGGTEEA
TYESPEDGTISGHVLLKRNLVIRQQVLQRVVDTYDRDSDEPTITDEFLLYRLGENKDNRL
RDIVSTIQAEQDQIIRSVRNTAIVIQGVAGSGKTTVALHRLAFLLYQYRDNIRAERMIIF
APNSMFLDYISGVLPELGVGHIQQTIFQDWTLALLDNAVKLTDSTKRLAYWFNIGAKKPQ
IDNQAPGRFKGSIAFLHYIDEKLQQFEAACLPTADLVAWEGKTLLNKTVHEWFYVENKHY
PLMKRRDRTVARMKRWIEIELTKFPSESMRKEYKKKANDRLRAYLKQWPEESPFSFYKTI
FTEPHVPDELIKESNLLFKKKEVQPEDLAPLIYIHNRFYGIESEQMFDHVVIDEAQDFSP
FQVALLKEQTRGGSFTILGDLSQGIHAYQGIWNWDEISSLFEADRTMYHQLDRSYRSTME
IIHFANAVLSRGGEAITPAIPVFRSGEKVRLIELGNEQQKVEALLKAVGKLQESGLINTI
AIVDRTERECAILHEALTGKGLAANLIEAGQREYLGGISVLPVYLTKGLEFDAVLIIDAD
PLHYEQNFQDAKLLYVGCTRALHELWLFYVGEASPLFANLLYNEEINNGFAIEERWL
NT seq 2154 nt   +upstreamnt  +downstreamnt
atcttggaccagactcaaagtgcctatcaagacgagcttaaacagctcaagaaaacaacc
gatgaaatcgacaagcagctgcagaagattgtggaaacgccacgctacttcgggcaggat
ttaacggaacaggttttggatttaaatcgtgaggtcaagcgggagcatctgcaaaaagct
agtgcggagccatattttggacgtttggattatcaggaaattggtaaaacccaaccattt
ccgctttatatcggcaagaatggtgtcgagaatgacaaaacccatgaactattagttata
gattggcgtgcacctgtcgccagtcttttttactcttttacaggcggtacagaggaagcg
acttatgaatcaccagaggatggcaccatcagcgggcacgttctgttaaagcgaaattta
gtgattcgccagcaggtgctgcagcgtgtagtggatacctacgatcgagatagcgatgag
ccgacgataacggatgaattcttactctaccgactaggtgagaataaagataatcgcttg
cgagatatcgtttcaaccattcaagccgaacaggatcagattattcgctcggtaagaaat
acggctatcgtgattcaaggggttgctgggagtggaaaaacaacggtagctttgcatcgt
ctggctttcttgctctaccaatatcgcgataatatccgcgcggagcggatgattattttt
gccccgaatagcatgtttctcgattacatctcaggtgttctgccagagcttggtgtaggt
catattcaacaaacgatttttcaggattggactttggcattattagataatgcagtgaag
ctgactgattcgactaaacgcttagcttattggtttaatattggagcaaaaaaaccgcaa
attgataatcaagctccgggtcgttttaaaggctcgattgctttccttcattatatagat
gaaaaattacaacagtttgaagccgcttgcctacctacagcagatctagttgcttgggaa
gggaaaaccttgctcaataagacggttcatgaatggttttatgtcgagaacaagcattat
ccactaatgaaacgtcgtgatcgtactgtggcgcggatgaagcgctggatagaaattgag
ttaactaaatttcctagtgagtcgatgcgcaaagaatacaagaagaaagccaatgaccgc
ttgcgtgcctacttgaagcaatggccagaggaatccccgttttctttttacaaaactatt
ttcacagaacctcatgtaccagatgagttaattaaagaatctaacctgcttttcaagaaa
aaagaggttcaaccagaggatttagcaccgctcatttatatccacaatcggttttatgga
attgaaagcgagcaaatgtttgatcatgtagtgatagatgaagcccaggatttctcgccg
tttcaggtagctttacttaaggagcagacccgcggaggttcttttacgatactaggtgat
ttgtcgcaagggattcatgcttaccaggggatctggaattgggatgagatttcctcacta
tttgaggcagaccgcacgatgtatcatcaattggaccgcagctatcgttcgaccatggaa
attattcattttgccaatgccgtattgagtcgtggtggtgaagctattacaccagctatc
cctgtgttccgcagtggggaaaaggtacgtttgatcgaattgggcaatgagcagcaaaag
gtggaggctttattgaaggcagtaggcaagctgcaggaaagtggcttgattaatacgatt
gcaattgttgatcggacggaacgagaatgtgcaattctgcatgaggctttaacaggaaaa
ggcttggcagccaacttaattgaagcgggacaacgggaatatctcggtggaatctcggtg
cttccagtctatttaaccaaaggcttggaatttgatgctgtattgattattgatgcggat
ccgctccattatgaacagaatttccaggatgcgaagctgctttatgtcggttgtacgcgg
gcattgcacgagctgtggttattttatgtaggagaagcttcccctttattcgccaatcta
ttatataatgaagaaattaataatgggtttgctatagaggagagatggctttga

DBGET integrated database retrieval system