KEGG   Paenibacillus psychroresistens: EHS13_07980
Entry
EHS13_07980       CDS       T06328                                 

Definition
(GenBank) DNA polymerase domain-containing protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EHS13_07980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_07980
Enzymes [BR:ppsc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EHS13_07980
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EHS13_07980
SSDB
Other DBs
NCBI-ProteinID: QGQ94820
UniProt: A0A6B8RF59
LinkDB
Position
1768847..1769731
AA seq 294 aa
MSGNEAGILEIEGNQIPVSHPDKILWPKLKISKLLYLQKLTVLAPFLLPYCKNRYLTIIR
FPNGVQGKSFYQKNAPHPLPPYVKTAEKEGVEYIHLDSLSTLLWLGNLAALEFHASFEYI
GGDEPAEWVFDIDPSDEEEPRLMEAVAIIGETLETMGITSIPKTSGATGVQIIIPIQTGH
TFEELRKAGHFVSEYLVEKYPHLFTIERLIKNRGNKIYIDYIQHGLGKSIAAPYTPRARE
DATVSTPLLWEEVKQNINPKLFNLLTIEARLADKGDLISTMEKQDLSRILKIIK
NT seq 885 nt   +upstreamnt  +downstreamnt
atgagtgggaatgaagctggaattcttgagattgaaggaaatcaaatacccgtaagtcat
ccagataaaatactttggccgaaattaaaaatcagtaagttattatatctccaaaagttg
acggtccttgcaccctttctacttccctattgtaagaatcggtatctgacaataatccgt
tttcctaatggagtgcagggaaaatccttttatcagaaaaatgcaccgcaccccttgccg
ccctacgtgaagacggctgaaaaggaaggagtcgagtatattcatttagattctttgtct
acgttattatggcttggtaatcttgcagctcttgaatttcatgcttcttttgaatatatt
ggcggagacgagcctgctgaatgggtgtttgatattgatccaagtgatgaagaagaacct
cgattaatggaggcagttgcaatcattggtgaaacactagaaaccatgggaataacatcc
attcccaaaacctctggagcgaccggggttcaaatcattatccccattcaaaccggccac
accttcgaggagctgcggaaggcgggacactttgtaagtgaatatttggttgagaaatac
cctcatttattcacaatcgaacgcttgattaagaatcgcggcaataaaatatatatagat
tatatccagcatggtcttgggaaaagcatagctgcgccttatacgcctagggcaagagaa
gatgcaaccgtctcaacaccgctcttgtgggaagaagtgaagcaaaatatcaaccccaag
ctatttaatttattaacaatcgaagcacgtttggctgataaaggtgatcttatctctaca
atggagaaacaggatttgagtcgaatattgaaaataatcaaataa

DBGET integrated database retrieval system