KEGG   Paenibacillus psychroresistens: EHS13_13590
Entry
EHS13_13590       CDS       T06328                                 

Gene name
sbcD
Definition
(GenBank) exonuclease subunit SbcD
  KO
K03547  DNA repair protein SbcD/Mre11
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_13590 (sbcD)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_13590 (sbcD)
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-ProteinID: QGQ95836
UniProt: A0A6B8RK89
LinkDB
Position
3039069..3040238
AA seq 389 aa
MKIAHIADCHYGLGYPGPNHFSRFEDIIASMNYAADRIIEEGCKLVLFAGDAFKDARVFL
DRASLEITEFVSWLRKLSKAGIDVVVISGTPSHDAISAYFLIQQMNIPRIHVFTDPGHMI
LHDINISCLPGMNRSNIAANDEIRGLPAHEIHQIMTDRITEQCKELRSKCDAMYPTILMS
HLTFDLADTGFEDALLQNEPILLQEATELFDLVALGHIHRPQKAGLNVYYSGAPERHNFG
DEKTATGFWIHEIHPAEWVHTYVVNPKSRKFKTLRWCDMDIQAWLDGELDTFDGVNSSIV
RVHYSCSEELQKLFDRQTLEKALYSARAYFVYEIKADIERTDRARDVEVTEALGPLTALQ
KWATNQGIETPEIIMLQSMTSTLLEGVAP
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgaaaatagcgcatattgcagattgtcactatggactaggttatcctggtccgaatcac
ttttctagatttgaagatatcattgcttctatgaattatgctgcagatcggattattgaa
gaaggttgtaaattagttctgttcgcgggagacgcattcaaggatgctcgagtgtttctg
gaccgtgccagtttagaaatcactgagtttgtttcttggttacgaaagttatctaaagca
gggattgatgttgttgttataagtggtaccccttcacatgatgcgattagtgcctatttt
ctcattcaacaaatgaatattccgcgtatccatgttttcaccgatccaggtcatatgatc
ttacatgatattaatatatcctgtttaccgggtatgaatcgcagcaatatagctgcaaat
gatgaaattcgcggtttaccagctcacgagattcaccaaattatgacggaccggataacg
gaacaatgcaaagagctccggtccaagtgtgatgcgatgtacccaactattttaatgtcg
catctaacatttgatttagctgataccggatttgaagatgctctgttgcaaaacgaacct
attttattgcaagaagctactgagttatttgatctcgtagcactcgggcacattcaccgg
ccacagaaagctggacttaatgtttattacagtggtgcacctgaaagacataactttggt
gatgagaaaacggcaactggtttctggattcacgaaatacatcctgctgaatgggttcac
acatatgtagtaaaccccaagtctcgtaagttcaaaacacttcgatggtgtgatatggat
atccaagcctggcttgatggtgaattggatacctttgatggagttaattcttcaattgtt
cgtgtacattactcctgcagcgaggaattacaaaagctgtttgatcgtcaaactttagaa
aaagcgttgtatagtgctagagcttatttcgtttacgagattaaagcagatatcgaacgg
accgaccgagcacgtgatgtagaagttacggaggctttaggtcctctcacagctctgcag
aaatgggcaacaaatcaagggattgaaactccggagattattatgctacagagtatgaca
tcaacgctgcttgagggggtggccccatga

DBGET integrated database retrieval system