KEGG   Paenibacillus psychroresistens: EHS13_16140
Entry
EHS13_16140       CDS       T06328                                 

Gene name
recA
Definition
(GenBank) recombinase RecA
  KO
K03553  recombination protein RecA
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_16140 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_16140 (recA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_16140 (recA)
    RecFOR pathway proteins
     EHS13_16140 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    EHS13_16140 (recA)
SSDB
Motif
Pfam: RecA Rad51 ATPase AAA_24 ATPase_2 AAA_25 CobU AAA CbiA AAA_16
Other DBs
NCBI-ProteinID: QGR00120
UniProt: A0A6B8RWX4
LinkDB
Position
3609228..3610241
AA seq 337 aa
MALRNIEKQFGKGSIMKLGESTHMQIEAISTGALALDIALGVGGFPRGRIIEVFGPESSG
KTTVALHAIASVQKNGGTAAFIDAEHALDPAYAAKLGINIDELLLSQPDTGEQALEIAEA
LVRSGAVDIIVVDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAINKSKVIAIF
INQLREKVGVMFGNPEVTPGGRALKFYSTIRLDVRRIESIKQGNDVVGNRTRIKVVKNKV
APPFKQAEVDIMYGEGISKEGSLIDIGTEMDIVDKSGAWYSFEGERLGQGRENAKQYLKD
NHKVTDIIEKKIREATITVPAVTSATADDDAEDLDFE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggctttacgtaatattgagaaacaatttggaaaaggctccataatgaagcttggcgaa
tccacgcatatgcaaattgaagctatttccactggagcattagcccttgatattgctctt
ggagttggtggttttccacgcgggcgtattattgaagtattcggacctgaatcctcaggt
aagactacagttgcgctacatgccattgcatcggtacagaagaatggcggtacggctgct
tttattgatgccgagcatgcattggatccagcctatgcagccaagcttgggatcaacata
gatgagttgttgctttcacagcccgatacaggcgagcaagcacttgaaattgcagaagca
cttgtacgaagcggtgcggtcgatattattgttgttgactccgtagcggctttggtgcct
aaggctgaaatcgaaggggacatgggagattcacatgtcggcctacaagcaagattgatg
tcacaggctttaagaaagctatcaggtgcaatcaacaagtccaaggttatcgcaattttc
attaatcagcttcgggaaaaagtcggcgttatgtttggtaatccagaggttactccaggt
ggacgagctcttaaattctattccactattcgtttggatgtacgtcggattgaatccatc
aagcaaggcaacgatgtagtgggtaaccgtacacgcattaaagtagtgaagaacaaagtc
gctcctccttttaaacaagctgaagttgatatcatgtacggtgaaggcatttccaaagaa
ggcagcctgattgatattggtaccgagatggatatcgtggataagagcggtgcttggtat
tcattcgaaggtgaaagattaggtcaaggccgtgagaatgctaagcagtatttgaaggac
aaccacaaggtaacggatattattgagaagaaaattagagaagcaactataacggtacct
gcggtaaccagtgcaactgctgatgatgatgcagaagatttggattttgaataa

DBGET integrated database retrieval system