KEGG   Paenibacillus psychroresistens: EHS13_18380
Entry
EHS13_18380       CDS       T06328                                 

Gene name
lexA
Definition
(GenBank) transcriptional repressor LexA
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppsc01002]
    EHS13_18380 (lexA)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_18380 (lexA)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     EHS13_18380 (lexA)
Peptidases and inhibitors [BR:ppsc01002]
 Serine peptidases
  Family S24: LexA family
   EHS13_18380 (lexA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    EHS13_18380 (lexA)
SSDB
Motif
Pfam: Peptidase_S24 LexA_DNA_bind MarR_2 HTH_IclR HTH_24 MarR TrmB Penicillinase_R DUF5821 HTH_20 HTH_Crp_2 BLACT_WH HTH_11 HTH_5 DUF5588 KfrA_N
Other DBs
NCBI-ProteinID: QGQ96707
UniProt: A0A6B8RLH5
LinkDB
Position
4082636..4083256
AA seq 206 aa
MSKISNRQLAILDFIKSEVREKGYPPSVREIGESVGLASSSTVHGHLERLEKKGLIRRDP
TKPRAIEILGLDDSASAFAHTITRVPLIGRVTAGVPITASENIEDYFPLPNHFVKDDEVY
MLSVMGESMIEVGIHDGDYVIVRQQSSANNGDIVVAMNEDDEATVKTFYKEKDHIRLQPE
NASMEPIRLNKVTILGKVIGLFRSIH
NT seq 621 nt   +upstreamnt  +downstreamnt
atgagtaagatttcaaacagacaacttgccattctagattttataaaaagtgaagttaga
gagaaaggttatcctccatccgttcgcgaaatcggtgaatccgttggcttagcttctagt
tccacggttcatggccatttagagcgcttagagaaaaaaggcttaattagacgtgaccct
accaaaccaagagctattgaaatattaggtttagatgattcagcttctgcttttgcacat
actattaccagagtccctttaattggtagagttactgcaggtgttcccattacagctagt
gagaacatcgaggattactttccgctacctaaccattttgtcaaagatgatgaagtttac
atgctaagcgtaatgggagaaagtatgatcgaagtgggaattcatgacggagattacgtt
atagttcgtcagcagtcctccgctaataatggagacatcgtagtggctatgaatgaagat
gacgaggcaactgttaaaaccttttataaagagaaggatcacattcgcttacagccggag
aatgcctctatggagccaattcgtttgaataaagtaaccattctcggtaaggttattggt
ttattccgcagtattcactaa

DBGET integrated database retrieval system