KEGG   Paenibacillus psychroresistens: EHS13_18465
Entry
EHS13_18465       CDS       T06328                                 

Gene name
mutS
Definition
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    EHS13_18465 (mutS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_18465 (mutS)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     EHS13_18465 (mutS)
SSDB
Motif
Pfam: MutS_V MutS_I MutS_III MutS_IV MutS_II AAA_14 AAA_29 AAA_27 AAA_30
Other DBs
NCBI-ProteinID: QGQ96721
UniProt: A0A6B8RJY2
LinkDB
Position
complement(4101569..4104190)
AA seq 873 aa
MIKYTPMIEQYLLVKAEVPDAFLFFRLGDFYEMFFDDAILASKELEITLTGRDGGTQEKI
PMCGIPYHAAENYIARLIEKGYKVAICEQVEKPEEAKGIVRREIVRIVTPGTLMEGKMLS
DSVNNYIAAAIAHDDKYGFAVCDLSTGELHVTSVELSLELLLDEFTAFAPSEMLGAADLV
EQVRANLLLTSKAVVFTQWDSVDEQFTRQHFAAEHIKPLDPACLYALTLLMNYLSATQKR
MLSHITHIRQYESNQFMMMDSFTRRNLELVETVRERSKKGSLLWLLDESVTSMGGRMLRR
WIEKPLMQVAQIDQRLEAVDCFYRQLIIRDDIRHHLQQIYDLERLTARISYGSANGRDLL
ALQLSLAAIPALRQICLDSDSNTLQQLAKRMDLCEDVLSWISAAIVDEPPVSIRDGGIIR
DGYHEHLDQLKEADRNGKQWMAELERQEREKTGIKSLKIGYNRIFGYYIEITRSHLVNLP
EGTYERKQTLANAERFVTPELKEKEALILEAQEKMVDIEQELFIKLREQIAQQISRLQQL
AEIVAEVDVYQSLATVSAANRFKRPYLTDGYSFQVGQGRHPVVETVMKSGSFVANDTHLS
EEDGIVLLITGPNMAGKSTYMRQVAIIAIMAQIGCFVPAEHANVSLIDRIFTRIGAADDL
IAGQSTFMVEMMDIQVMTEKATKRSLVIIDELGRGTSTGEGMAIAQAVIEFMHDEIGCKT
LVSTHFHELAHLEETLSSLRNYCMAVRESNQQVTFLRKLIPGAADTSYGIYCARIAGLPE
SIIQRSYTLLNGFIARESIAPYETQQVAAAAEPFVQLSLFAEADKPQADKAKKKLDPKTE
QVIDELRNADIINMTPLQAMNLVYELKKKLAEK
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgattaaatatacaccaatgatagaacaatacttgttagtaaaagcagaagtgcccgat
gcttttttattttttcgactcggtgatttctatgaaatgttttttgatgacgcgatatta
gcttctaaagaattggaaataaccttaacaggcagagatggcgggactcaagagaaaatt
ccgatgtgtggaattccttatcatgctgcagagaattatatagcccgcttaattgaaaaa
ggctataaagtcgcgatttgtgagcaagtagagaaaccagaagaggccaaaggtatcgta
cgccgtgaaattgtgcggattgttactccaggaactctaatggaaggcaagatgcttagt
gattccgttaataactatattgcagcggctatagctcacgatgataaatatggctttgcc
gtttgtgatctgtcgactggagagcttcatgttacttctgttgaactctcgcttgagctt
ctattggatgaatttacggcgttcgcaccttcagaaatgttgggtgccgcagatttagtg
gagcaagtaagagctaatttattgctgacttctaaagcagttgtttttactcaatgggac
tctgtagatgaacaattcactcgacagcatttcgctgcggagcatattaagccgctcgac
ccagcatgcttgtacgcgctaaccttattaatgaattatctgagcgctacacagaaaaga
atgctttcgcacattacgcatattaggcaatatgaatccaatcagtttatgatgatggat
tccttcaccagacggaacctggaattggttgaaacggtaagggagcgcagcaaaaaaggc
tcattgctatggctgctggatgaaagtgttacctctatgggcggaagaatgctgcgtcga
tggattgagaagccgcttatgcaagttgcgcagattgatcaaagactggaagcggtagat
tgcttttatcgccagttgatcattcgtgacgatattcgtcaccatttacaacagatttat
gatttggagcgtttaacagctcgaatctcctatggtagtgctaatggacgagatttgctc
gccctgcagctgtcactagcggctattccagccttgcgccagatttgcctcgattcggat
tccaatactctacagcaattagccaagcgtatggatctctgtgaggatgtattaagctgg
atttcagcagcgatagtggacgagcccccagtatcgattcgagatggcggaatcattcgt
gatggttaccatgagcatctggaccagttaaaagaagccgatcgcaatggcaagcagtgg
atggccgagctcgagcggcaggaacgagaaaagacaggaattaaatcattaaaaattggc
tataatcggatatttggttattacatagaaataacgaggtcacatctggtcaatctgcct
gaaggtacttatgaacgtaaacaaacgcttgctaatgctgaacgttttgtaacacctgag
cttaaggaaaaagaagccttgatccttgaagcgcaagagaaaatggtcgatatcgagcag
gagctgtttattaagctaagggaacaaattgcacagcaaatttcccgcttgcagcagctt
gctgaaattgtggctgaggtagacgtctatcaatcacttgctaccgtaagtgcagcgaat
cgctttaaacgtccttatcttacggatggctacagctttcaagtcggacaaggcagacat
ccggttgtggaaactgtgatgaaatcaggctcatttgtggccaatgacacccatttaagt
gaagaggatggcatagttttattgattaccggacctaatatggcgggtaaaagcacttat
atgcgacaagttgctatcattgcgattatggctcaaatcggttgctttgtgcccgctgag
catgctaacgtttcgctgattgatcgaatttttacgcggattggagctgctgatgattta
attgccggtcagagtacttttatggtagaaatgatggatattcaagtcatgacggagaaa
gctaccaaacgcagcttagtgattattgatgagctgggtagaggaacgtcaacaggtgag
ggaatggctatcgcccaagctgtgattgaatttatgcacgatgagattggctgcaagacc
ctggtctcgacgcattttcatgaattggctcatttggaggaaaccttaagctctttacgc
aattattgcatggcagtcagagaaagcaaccagcaggtgactttcttacgcaagctgata
cccggagcggcagataccagctatggcatctattgtgcccgtatagcaggcttgcctgaa
tcgattatccaaagatcctatacgttattaaatggttttatagctagagaatcgatagct
ccgtatgagactcagcaggtagctgctgccgcagagccttttgtacagcttagcttattt
gctgaagcggacaagccgcaggcggataaagccaaaaagaagctggatcctaaaaccgag
caggtcatagatgagcttcgcaatgcagacatcatcaacatgacacctttgcaagcgatg
aatttggtttatgagctcaagaaaaagctagctgagaaataa

DBGET integrated database retrieval system