KEGG   Paenibacillus psychroresistens: EHS13_20105
Entry
EHS13_20105       CDS       T06328                                 

Definition
(GenBank) hypothetical protein
  KO
K07455  recombination protein RecT
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_20105
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EHS13_20105
SSDB
Motif
Pfam: RecT
Other DBs
NCBI-ProteinID: QGQ97022
UniProt: A0A6B8RMV4
LinkDB
Position
complement(4420809..4421756)
AA seq 315 aa
MANQIVEYKKFTFGDLDETMIQTIHETIAKDCTEPQFRLFMTIAKSLGANPLLNEIYPTV
YSGKLTPQFGIGFYVTQARKHKDYRGYDVQLVHENDEFSMHQEKDEGDERYYTVIDKHSW
GFPRGKIIGCYAFAYREGFKPFSVVMGIEEVDHLRNSNIGMQKAMWNNNTGDMFKKHISK
RALSAGFGLGFDDEELSGDTGGNEPYVRKEINPEADPVIITEPVTKTTKTRASEAAGAVE
AEVTPIDEVAERKVVNGTIKAKLKELGITTDAAILDYMNTNMKAATPDSPTLAERKTLLK
FIEKQIADKSDELEP
NT seq 948 nt   +upstreamnt  +downstreamnt
ttggctaatcaaattgttgaatacaaaaagtttacctttggcgacctggacgaaacaatg
atccagactattcatgaaaccattgctaaggattgcaccgaaccacaattcaggttgttt
atgaccatcgctaaatcacttggagctaatccactgcttaatgaaatctatccaaccgta
tattccggtaaattaactcctcagttcggtattggcttttatgtcacccaagctcgtaaa
cataaagattatcgcggttatgatgtacagctggttcatgagaatgacgaattcagcatg
catcaagaaaaggatgaaggcgacgaacgctattataccgttattgataagcatagctgg
ggtttccctagaggtaaaattataggctgctacgcattcgcttatagggaagggttcaaa
ccattctcggttgtaatggggatcgaggaagtggatcatctccgcaattccaatatcggt
atgcaaaaggcgatgtggaataacaacactggcgatatgttcaagaaacatatttccaag
cgggctttaagtgctggtttcggattagggtttgatgatgaggaattgtctggagataca
ggcgggaatgagccttatgttaggaaagaaatcaacccagaagcggatccggttattatc
actgagccggtaaccaagaccactaaaacaagagcttcagaagctgcgggcgctgttgaa
gcggaggtaacgcctatagatgaagttgccgagcgcaaagtagtcaacggcaccattaag
gccaaactgaaagaattgggaattaccacagatgcagccattctcgattatatgaatacc
aacatgaaggcagcaacaccagattccccgacgcttgctgagcgtaaaaccttactaaag
ttcattgaaaaacaaatcgccgataagagcgatgagcttgaaccttga

DBGET integrated database retrieval system