KEGG   Paenibacillus psychroresistens: EHS13_22015
Entry
EHS13_22015       CDS       T06328                                 

Definition
(GenBank) ribonucleoside-diphosphate reductase
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc00230  Purine metabolism
ppsc00240  Pyrimidine metabolism
ppsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EHS13_22015
   00240 Pyrimidine metabolism
    EHS13_22015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_22015
Enzymes [BR:ppsc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     EHS13_22015
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    EHS13_22015
SSDB
Motif
Pfam: Ribonuc_red_lgC LAGLIDADG_3 Intein_splicing Hint_2 ProQ_C Ribonuc_red_lgN
Other DBs
NCBI-ProteinID: QGQ97367
UniProt: A0A6B8RNE9
LinkDB
Position
complement(4821566..4825267)
AA seq 1233 aa
MDTVQTTRLEGLSEKIFLDRYALKDADTNNTKVGDLVLALTKDDAKFPAKEVGEVIKREG
NRVSIKLSSGDIIETTIEKLTLTKEKTPDQLWKRLAGAMASVEFTPEKQKEWTDKFKYIL
QDWKLVPGGRIAAGADASDELTLFNCYVIPSPQDSRGGIMKTLTEMTEIMARGGGVGINL
SSLRPRRAIVKGVNGASSGAVSWGGLFSYATGLIEQGGSRRGALMLMINDWHPDLVDFIT
VKQTAGQVTNANLSVCVSNGFMKAVKEDLDWDLVFPDTNDADYNTLWDGSLEKWKALGKA
VKLIQTVKAREVWKIIIESAWKSAEPGVVFMERYNEMSNSWYFNPIICTNPCFHADTRIS
TEFGLIRIDDLFNKVGMGHFLAATDDRIMNEVQVVNGRSYAVPGTTMRRARVFPTGVKQT
LKIELANGMELKVTPDHRILTQLGWKEAKDLTYEDQVYIQSGAGQFAAEDELGRDWGLFL
GWLTGDGWISQRGDIGMVFGKEDEEVVARMVEIGLRLTGTEAKVFEREGGTKQVYWWKKH
FRDQLLKLGVKQVKAPEKEVPAALFTSTRETVIAFIQGLFSADGTVYENDEMHRSVRLTS
ASRKLLQDVQLLLLNFGIHGHIYSRAKNNQAQFTYRTIDGVDKSYESKGFFELILSGNNI
LEFQMQIGFSLLNRKQEALERIARPSRKSEKFISQVKIITEGEAVMVYDVNEPATHSLIA
NGVVAHNCGEQGLPAWGVCNLAAVNLSKFYDADKQDVAWDELGKVVRYSTRFLDNVIDKT
PYHFEENKENQQGERRVGLGTMGLAELMIKLEIRYGSPESLTFLDKLYGYMAKEAYIASA
EIAEEKGSFKHFKLDKFLQSGFMKNMVKIYPEVGAAIEKKGMRNVTVITQAPTGSTGTMV
GTSTGIEPYFAFEYFRQSRLGYDKQLVPIAQNWLDKHPNQELPDYYVTSMSLSAEDHIRV
QAAIQTWVDSSISKTANCPADFTVEETARLYELAFDLGCKGVTIYRDGSRDVQVLSTEKK
AAEKESAVAAALPEEELAAEEASANISIKNQEIHDKQYKSRPQILRGATYKVNTPFGMAY
ITINDLNGIPSEIFLNVGKAGSDVFAMSEALGRVCSLFLRYGDHGNKVNLLIKHLKGIGG
SGAIGFGVNRVESIADAVAKSLELHNEGSNNGYVSVVHNPTAPEAATLDYDVTVPSVHTS
STSSKDICPSCGSISLINIEGCKTCSNCGYSKC
NT seq 3702 nt   +upstreamnt  +downstreamnt
atggatactgtgcagaccacgagattagaaggattaagcgaaaagatttttctcgatcgt
tatgctttaaaggatgcagataccaataataccaaggttggcgatctggtattagcttta
actaaagacgatgccaaatttccggctaaagaagttggagaagtcattaaacgcgaaggc
aatcgagtttcaataaagcttagcagtggcgatattatcgaaacaaccattgagaagctt
actttgaccaaagaaaaaacaccagaccagctctggaagcgtctggctggagcaatggca
tctgtagaatttactcccgagaaacaaaaggaatggaccgataaattcaaatatattttg
caggattggaagcttgtgcctggaggacgtattgctgctggtgcggatgcgagtgatgaa
ttaacactgtttaattgttatgtaataccatctccacaagacagtcgtggcgggattatg
aaaacattaactgaaatgactgaaatcatggcacgcggtggtggagtggggattaatctt
tcctctttaagaccacggagagcaattgttaaaggagtcaatggtgcatcaagtggtgct
gtttcatggggaggattatttagttatgctactggtttgatcgagcagggtggtagtcgc
cgcggagcattaatgctgatgatcaatgattggcatcccgatctagtcgactttattacc
gtcaaacaaacggctggacaagttaccaatgctaacttatctgtttgcgtaagtaatggt
ttcatgaaagcggtcaaagaggacttggattgggatttggttttcccagacacgaatgat
gcagattacaatacactgtgggacggcagcctcgaaaagtggaaggcactgggtaaagcg
gtcaagctcattcaaaccgtaaaagcacgcgaggtatggaaaataatcatcgagtcagct
tggaaatcagccgagcccggtgtggtttttatggagcgatataatgagatgtctaatagc
tggtattttaacccgattatttgtactaatccatgctttcatgcagatactcgcatttca
actgaatttggtttaattcggattgatgacctatttaataaagtgggcatgggacatttt
ttggcagctacggatgatcgaatcatgaatgaagttcaagtggttaatgggcgttcctat
gcagtcccaggcacaactatgcggagggctcgtgtttttccaactggggttaaacaaact
ctgaagatagaattagcaaatgggatggagcttaaagttacacctgatcaccgaatcctt
acacaattaggttggaaagaagccaaggatttaacttatgaggatcaagtatacatccaa
tctggagcagggcaatttgcagcagaagatgagctgggtagagattggggcttatttctt
ggatggcttactggggacggctggatttcacagcgtggagatattggaatggtttttggc
aaagaggatgaagaagtcgtagcccgaatggttgaaattggactaagattaacaggaacg
gaagctaaagtattcgaaagagaaggcggaacgaagcaagtttattggtggaaaaaacat
tttagagaccagctgctaaagcttggtgtgaaacaagtaaaagctccagaaaaagaggtc
ccagctgcattatttacttctactcgtgaaaccgtaattgcatttatccaaggattattc
agtgctgatggaaccgtatatgagaatgatgaaatgcaccgatcagttagacttacatcc
gcttcacgtaaattgcttcaagatgttcaattgttgttgcttaattttgggatccatgga
catatctatagtcgagccaagaataatcaagctcaatttacttatcgcacaatcgatgga
gtcgataagtcatatgaatctaaaggattcttcgagttaattctgagtggcaataacatt
cttgagtttcagatgcagatcgggttctcattattaaatcgtaagcaagaagcattggaa
agaatcgcacgtccatcacgtaaaagcgagaaattcatctctcaagtaaaaatcattaca
gaaggtgaggcggtaatggtttacgatgtcaatgagccagcgactcattctttgattgct
aatggggttgtagctcacaactgcggagaacaaggcctaccagcatggggagtttgcaac
ctggctgcagttaatctctctaaattctatgatgctgacaaacaagatgtagcatgggat
gagctcggaaaggtggtgcgttattccacacgttttttagataatgttatcgataagaca
ccgtatcattttgaggaaaataaagagaatcaacaaggagaacgtcgagtaggtttagga
acaatgggacttgctgagttgatgataaagctagaaattcgctatggcagcccagaatca
ctcacttttttggataagctttatggctatatggccaaagaagcctatatcgcctcagcc
gagattgctgaagaaaaaggctcatttaagcatttcaagctggataaatttctccaaagc
ggctttatgaaaaatatggtcaaaatatatccagaagttggagcagcgattgagaaaaaa
ggcatgcgcaatgttactgtaattactcaagcaccaactggcagtacaggaacgatggtc
ggaacatcgacagggattgaaccctatttcgcttttgaatacttccgtcaaagtcgcttg
ggttatgataaacaattagtgccgattgcgcagaattggttggataagcaccctaatcaa
gaactgccggattactatgtaacatcaatgtctctatcggctgaggatcatattcgtgta
caagcagctattcaaacatgggtggacagctctatttccaaaacggcaaattgtccagca
gacttcaccgtagaagaaactgcacgattgtatgagcttgcttttgacctaggttgcaag
ggagtgacgatttaccgtgatggtagccgtgatgtccaagtgctttccaccgagaaaaaa
gcagctgaaaaagaatcggctgtagctgccgccttacccgaagaagaattagctgctgag
gaagcttcagcgaatattagcattaaaaatcaggaaattcacgacaagcaatataaaagt
cgtccgcaaattctgagaggtgcaacttacaaagtaaacacaccattcggaatggcttat
atcacaattaatgatttaaacggcattccaagtgaaatcttcttgaatgtaggtaaagca
ggttccgacgtcttcgcaatgtccgaagcgttaggccgagtttgctccttgttcctccgt
tatggagatcacggcaataaagttaacttgctgattaaacatcttaaaggtattggcggt
tcaggtgcaataggctttggagttaaccgcgttgaatccattgcggatgcagtagctaaa
tcattagagctccataatgaaggcagcaataacggatatgtttcggttgttcataacccg
acagcacccgaagcagccacactggattatgatgtaactgttccaagtgtacacacgtcc
agtacttcgagcaaagatatatgtccatcctgcggatctatttcattgatcaatatagaa
ggttgtaaaacgtgcagtaattgcgggtatagtaagtgttga

DBGET integrated database retrieval system