KEGG   Paenibacillus psychroresistens: EHS13_32355
Entry
EHS13_32355       CDS       T06328                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_32355 (recR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_32355 (recR)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     EHS13_32355 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EHS13_32355 (recR)
SSDB
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH IMS_HHH HHH_8 Cdd1
Other DBs
NCBI-ProteinID: QGR00344
UniProt: A0A6B8RYK9
LinkDB
Position
complement(7217692..7218291)
AA seq 199 aa
MYYPEALAKLIDAFTRLPGIGPKTAGRLAFHVLRMKEEDVTDFAKALVNVKRNLHYCSVC
CNITDIDPCRICMDKSRDPSIICVIQEPKDLVAMERTREFRGYYHVLHGAISPMEGIGPD
EIYVAELLKRLGDDTVQELIMATNPNIEGEATAMYLSRLIKPFGIKVTRIAHGLPVGGDM
EYADEVTLTKALEGRRELN
NT seq 600 nt   +upstreamnt  +downstreamnt
gtgtattacccagaagctttagctaaattaatagatgcctttacgcgcttgcccggaatt
ggtccgaaaaccgcaggaagactagcttttcatgtgcttcgaatgaaagaggaagatgtg
accgattttgccaaagcacttgtaaatgtcaaaagaaaccttcattactgttccgtctgc
tgcaatatcacagatatagatccttgtaggatctgtatggataagagtagggatccgtcg
attatttgtgtcatacaagagcccaaggatctagtggcgatggaaagaacgcgtgagttc
cgtggttactaccatgtccttcatggggctatttctccaatggaaggcattggtccagat
gaaatctatgtggcggagctcctgaagcgtcttggtgatgataccgtgcaggaattgatt
atggctactaaccccaatattgaaggagaagctacagcgatgtatctatctcgattgatt
aaaccatttggcattaaagtcacacgtattgctcatggattgccggtaggtggagacatg
gaatatgcggatgaagtaactctgactaaggcattagaaggtcgacgcgagttgaattga

DBGET integrated database retrieval system